ARMX3_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARMX3_RAT
• UniProt AC: Q5XID7
• Protein Name: Armadillo repeat-containing X-linked protein 3
• Gene Name: Armcx3
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 379
• Subcellular Localization: Mitochondrion outer membrane ; Single-pass membrane protein . Cytoplasm . Nucleus .
• Protein Description: Regulates mitochondrial aggregation and transport in axons in living neurons. May link mitochondria to the Trak2-kinesin motor complex via its interaction with Miro and Trak2. Mitochondrial distribution and dynamics is regulated through Armcx3 protein degradation, which is promoted by PCK and negatively regulated by Wnt1. Enhances the Sox10-mediated transactivation of the neuronal acetylcholine receptor subunit alpha-3 and beta-4 subunit gene promoters..
• Protein Sequence: MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGPGDVEDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKIYMNQVCDDTVTSRLNSSVQLAGLRLLTNMTVTNEYQHILANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLGAHVPSSLGSLFNKKEYKEVILKLLSIFENINDNFKWEENEPAQNHFSEGSLFFFLKEFQVCADKVLGIESHHDFQVRVKVGKFVTKLTERMFPKSQE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
53	Phosphorylation	VEDAGDCSGARYNDW HHHCCCCCCCCCCCC	39.98	28432305
57	Phosphorylation	GDCSGARYNDWSDDD CCCCCCCCCCCCCCC	19.55	28432305
61	Phosphorylation	GARYNDWSDDDDDSN CCCCCCCCCCCCCCC	33.74	23712012
67	Phosphorylation	WSDDDDDSNESKSIV CCCCCCCCCCCCCEE	49.87	28551015
70	Phosphorylation	DDDDSNESKSIVWYP CCCCCCCCCCEEEEC	35.63	28432305
72	Phosphorylation	DDSNESKSIVWYPPW CCCCCCCCEEEECCC	31.49	27097102
76	Phosphorylation	ESKSIVWYPPWARIG CCCCEEEECCCCCCC	6.63	16641100
110	Phosphorylation	RAVQKRASPNSDDTV HHHHHHCCCCCCCCC	28.75	27097102
113	Phosphorylation	QKRASPNSDDTVLSP HHHCCCCCCCCCCCH	40.00	27097102
116	Phosphorylation	ASPNSDDTVLSPQEL CCCCCCCCCCCHHHH	28.47	27097102
182	Ubiquitination	RDPIVKEKALIVLNN CCHHHCHHHEEEEEC	42.65	-
364	Acetylation	QVRVKVGKFVTKLTE EEHHHHHHHHHHHHH	39.38	22902405

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARMX3_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARMX3_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARMX3_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of ARMX3_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.