UniProt ID | ARL8B_RAT | |
---|---|---|
UniProt AC | Q66HA6 | |
Protein Name | ADP-ribosylation factor-like protein 8B | |
Gene Name | Arl8b | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 186 | |
Subcellular Localization | Late endosome membrane . Lysosome membrane . Cytoplasm, cytoskeleton, spindle . Localizes with microtubules at the spindle mid-zone during mitosis. | |
Protein Description | May play a role in lysosome motility. May play a role in chromosome segregation.. | |
Protein Sequence | MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
62 | Ubiquitination | FNMRKVTKGNVTIKI EEEEEECCCCEEEEE | 52.02 | - | |
68 | Ubiquitination | TKGNVTIKIWDIGGQ CCCCEEEEEEECCCC | 28.51 | - | |
141 | Acetylation | LPNALDEKQLIEKMN CCCCCCHHHHHHHCC | 50.50 | 22902405 | |
141 | Ubiquitination | LPNALDEKQLIEKMN CCCCCCHHHHHHHCC | 50.50 | - | |
150 | Phosphorylation | LIEKMNLSAIQDREI HHHHCCHHHHCCCEE | 20.51 | 27097102 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARL8B_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARL8B_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARL8B_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ARL8B_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...