| UniProt ID | ARL8A_MOUSE | |
|---|---|---|
| UniProt AC | Q8VEH3 | |
| Protein Name | ADP-ribosylation factor-like protein 8A | |
| Gene Name | Arl8a | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 186 | |
| Subcellular Localization | Late endosome membrane. Lysosome membrane. | |
| Protein Description | May play a role in lysosomes motility. Alternatively, may play a role in chromosome segregation (By similarity).. | |
| Protein Sequence | MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLAGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 30 | Phosphorylation | LTLVGLQYSGKTTFV EEEEEEEECCCEEEE | 25.16 | - | |
| 31 | Phosphorylation | TLVGLQYSGKTTFVN EEEEEEECCCEEEEE | 22.35 | - | |
| 34 | Phosphorylation | GLQYSGKTTFVNVIA EEEECCCEEEEEEEE | 29.05 | 29899451 | |
| 35 | Phosphorylation | LQYSGKTTFVNVIAS EEECCCEEEEEEEEC | 29.13 | 29899451 | |
| 42 | Phosphorylation | TFVNVIASGQFNEDM EEEEEEECCCCCCCC | 23.23 | 29899451 | |
| 62 | Ubiquitination | FNMRKITKGNVTIKL EEEEEECCCCEEEEE | 52.54 | 22790023 | |
| 68 | Ubiquitination | TKGNVTIKLWDIGGQ CCCCEEEEEEECCCC | 33.87 | 22790023 | |
| 86 | Glutathionylation | RSMWERYCRGVSAIV HHHHHHHHCCCCEEE | 3.70 | 24333276 | |
| 131 | Ubiquitination | PVLVLGNKRDLAGAL CEEEECCHHHHCCCC | 45.55 | 27667366 | |
| 141 | Ubiquitination | LAGALDEKELIEKMN HCCCCCHHHHHHHCC | 58.44 | 22790023 | |
| 146 | Ubiquitination | DEKELIEKMNLSAIQ CHHHHHHHCCHHHHC | 26.54 | 22790023 | |
| 150 | Phosphorylation | LIEKMNLSAIQDREI HHHHCCHHHHCCCEE | 20.51 | 28066266 | |
| 182 | Ubiquitination | QWLIQHSKSRRS--- HHHHHHHHHCCC--- | 45.95 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARL8A_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARL8A_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARL8A_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ARL8A_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
