| UniProt ID | ARL8A_HUMAN | |
|---|---|---|
| UniProt AC | Q96BM9 | |
| Protein Name | ADP-ribosylation factor-like protein 8A | |
| Gene Name | ARL8A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 186 | |
| Subcellular Localization | Late endosome membrane. Lysosome membrane. | |
| Protein Description | May play a role in lysosomes motility. Alternatively, may play a role in chromosome segregation (By similarity).. | |
| Protein Sequence | MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 62 | Ubiquitination | FNMRKITKGNVTIKL EEEEEECCCCEEEEE | 52.54 | - | |
| 66 | O-linked_Glycosylation | KITKGNVTIKLWDIG EECCCCEEEEEEECC | 19.18 | 29237092 | |
| 66 | Phosphorylation | KITKGNVTIKLWDIG EECCCCEEEEEEECC | 19.18 | 28060719 | |
| 68 | Ubiquitination | TKGNVTIKLWDIGGQ CCCCEEEEEEECCCC | 33.87 | 21890473 | |
| 85 | Phosphorylation | FRSMWERYCRGVSAI HHHHHHHHHCCCCEE | 3.80 | 30243723 | |
| 90 | Phosphorylation | ERYCRGVSAIVYMVD HHHHCCCCEEEEEEE | 18.33 | 30243723 | |
| 94 | Phosphorylation | RGVSAIVYMVDAADQ CCCCEEEEEEEHHHH | 5.82 | 30243723 | |
| 117 | Ubiquitination | ELHNLLDKPQLQGIP HHHHHCCCHHHCCCC | 34.33 | - | |
| 141 | Ubiquitination | LPGALDEKELIEKMN CCCCCCHHHHHHHCC | 58.44 | 21890473 | |
| 141 | 2-Hydroxyisobutyrylation | LPGALDEKELIEKMN CCCCCCHHHHHHHCC | 58.44 | - | |
| 146 | Ubiquitination | DEKELIEKMNLSAIQ CHHHHHHHCCHHHHC | 26.54 | - | |
| 150 | Phosphorylation | LIEKMNLSAIQDREI HHHHCCHHHHCCCEE | 20.51 | 21815630 | |
| 160 | Phosphorylation | QDREICCYSISCKEK CCCEEEEEEEEECCC | 12.48 | 28152594 | |
| 161 | Phosphorylation | DREICCYSISCKEKD CCEEEEEEEEECCCC | 8.29 | 28152594 | |
| 163 | Phosphorylation | EICCYSISCKEKDNI EEEEEEEEECCCCCC | 17.13 | 28152594 | |
| 182 | Ubiquitination | QWLIQHSKSRRS--- HHHHHHHHHCCC--- | 45.95 | 21890473 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARL8A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARL8A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARL8A_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ARL8A_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
