ARL2_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARL2_RAT
• UniProt AC: O08697
• Protein Name: ADP-ribosylation factor-like protein 2
• Gene Name: Arl2
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 184
• Subcellular Localization: Mitochondrion intermembrane space . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Nucleus . Cytoplasm . The complex formed with ARL2BP, ARL2 and SLC25A6 is expressed in mitochondria. Not detected in the Golgi, nucleus and on th
• Protein Description: Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Regulates formation of new microtubules and centrosome integrity. Prevents the TBCD-induced microtubule destruction. Participates in association with TBCD, in the disassembly of the apical junction complexes. Antagonizes the effect of TBCD on epithelial cell detachment and tight and adherens junctions disassembly. Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. Component of a regulated secretory pathway involved in Ca(2+)-dependent release of acetylcholine. Required for normal progress through the cell cycle (By similarity)..
• Protein Sequence: MGLLTILKKMKQKERDVRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSCNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSRVFTAD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGLLTILKK ------CCHHHHHHH	29.42	-
43	Phosphorylation	FNGEDVDTISPTLGF CCCCCCCCCCCCCCC	24.17	23984901
45	Phosphorylation	GEDVDTISPTLGFNI CCCCCCCCCCCCCEE	17.58	27097102
47	Phosphorylation	DVDTISPTLGFNIKT CCCCCCCCCCCEEEE	32.49	27097102
71	Ubiquitination	IWDVGGQKSLRSYWR EEECCCHHHHHHHHH	55.52	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARL2_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARL2_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARL2_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of ARL2_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.