| UniProt ID | ARL1_MOUSE | |
|---|---|---|
| UniProt AC | P61211 | |
| Protein Name | ADP-ribosylation factor-like protein 1 | |
| Gene Name | Arl1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 181 | |
| Subcellular Localization |
Golgi apparatus membrane Peripheral membrane protein Cytoplasmic side. Membrane Lipid-anchor . |
|
| Protein Description | GTP-binding protein. Can activate phospholipase D with very low efficiency. Important for normal function of the Golgi apparatus (By similarity).. | |
| Protein Sequence | MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTPSEMANALGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Myristoylation | ------MGGFFSSIF ------CCCHHHHHH | 41.43 | - | |
| 15 | Phosphorylation | IFSSLFGTREMRILI HHHHHHCCCCEEEEE | 19.00 | 27566939 | |
| 59 | Ubiquitination | NVETVTYKNLKFQVW EEEEEEEECCEEEEE | 46.57 | - | |
| 62 | Ubiquitination | TVTYKNLKFQVWDLG EEEEECCEEEEEECC | 43.05 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARL1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARL1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARL1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ARL1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...