ARL16_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARL16_HUMAN
• UniProt AC: Q0P5N6
• Protein Name: ADP-ribosylation factor-like protein 16
• Gene Name: ARL16
• Organism: Homo sapiens (Human).
• Sequence Length: 197
• Protein Sequence: MRVAGGRALSRGAELRVPGGAKHGMCLLLGATGVGKTLLVKRLQEVSSRDGKGDLGEPPPTRPTVGTNLTDIVAQRKITIRELGGCMGPIWSSYYGNCRSLLFVMDASDPTQLSASCVQLLGLLSAEQLAEASVLILFNKIDLPCYMSTEEMKSLIRLPDIIACAKQNITTAEISAREGTGLAGVLAWLQATHRAND

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
52	Ubiquitination	EVSSRDGKGDLGEPP HHHHCCCCCCCCCCC	54.24	21906983
100	Phosphorylation	SYYGNCRSLLFVMDA HHCCCCEEEEEEEEC	31.46	22210691
133	Phosphorylation	AEQLAEASVLILFNK HHHHHHHHHHHHHCC	14.68	22210691
153	Ubiquitination	YMSTEEMKSLIRLPD CCCHHHHHHHHCHHH	45.44	-
154	Phosphorylation	MSTEEMKSLIRLPDI CCHHHHHHHHCHHHH	27.93	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARL16_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARL16_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARL16_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of ARL16_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.