dbPTM

ARL15_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ARL15_MOUSE
UniProt AC	Q8BGR6
Protein Name	ADP-ribosylation factor-like protein 15
Gene Name	Arl15
Organism	Mus musculus (Mouse).
Sequence Length	204
Subcellular Localization
Protein Description
Protein Sequence	MSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSELCSESPENVVSTTGFSIKAVPFQNAVLNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLETARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDVDTLKDSFSQLINLLEEKDHEAVRM

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
37	S-palmitoylation	RPEYDLVCIGLTGSG CCCCCEEEEECCCCC	2.38	28680068
157	Ubiquitination	RSVQEIKKYFELEPL HCHHHHHHHHCCCCC	61.91	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ARL15_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ARL15_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ARL15_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ARL15_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ARL15_MOUSE

Related Literatures of Post-Translational Modification