ARL10_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARL10_MOUSE
• UniProt AC: Q9QXJ4
• Protein Name: ADP-ribosylation factor-like protein 10
• Gene Name: Arl10
• Organism: Mus musculus (Mouse).
• Sequence Length: 243
• Protein Sequence: MAPRPLGPLVLALGGAAAVLGSVLFILWKAYFGRGRERRWDRGEAWWGADTARLPQWDEWEPEDEEDEPALEELEQREVLVLGLDGSGKSTFLRMLAGKPPVEGHVPTWGFNSVRLPTKNFEVDLLEIGGSQNLRFYWKEFVNEVDVLVFMVDSTDRLRLPWARQELQKLLDRDPDLPVVIVANKQDLSGAMNMVELQQELGLLASYNQREVFLLAASIAPAGSGFGEPGTVHIWKLLLQLLS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
99	Ubiquitination	FLRMLAGKPPVEGHV HHHHHCCCCCCCCCC	40.31	22790023
99	Ubiquitination	FLRMLAGKPPVEGHV HHHHHCCCCCCCCCC	40.31	22790023
119	Ubiquitination	NSVRLPTKNFEVDLL CCEECCCCCEEEEEE	58.67	22790023
119	Ubiquitination	NSVRLPTKNFEVDLL CCEECCCCCEEEEEE	58.67	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARL10_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARL10_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARL10_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of ARL10_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.