UniProt ID | ARH_MOUSE | |
---|---|---|
UniProt AC | Q8C142 | |
Protein Name | Low density lipoprotein receptor adapter protein 1 {ECO:0000305} | |
Gene Name | Ldlrap1 {ECO:0000312|MGI:MGI:2140175} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 308 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Adapter protein (clathrin-associated sorting protein (CLASP)) required for efficient endocytosis of the LDL receptor (LDLR) in polarized cells such as hepatocytes and lymphocytes, but not in non-polarized cells (fibroblasts). May be required for LDL binding and internalization but not for receptor clustering in coated pits. May facilitate the endocytocis of LDLR and LDLR-LDL complexes from coated pits by stabilizing the interaction between the receptor and the structural components of the pits. May also be involved in the internalization of other LDLR family members. Binds to phosphoinositides, which regulate clathrin bud assembly at the cell surface. Required for trafficking of LRP2 to the endocytic recycling compartment which is necessary for LRP2 proteolysis, releasing a tail fragment which translocates to the nucleus and mediates transcriptional repression (By similarity).. | |
Protein Sequence | MDALKSAGRALIRSPSLAKQSWAGGRHRKLPENWTDTRETLLEGMVFSLKYLGMTLVERPKGEELSAAAVKRIVATAKASGKKLQKVTLKVSPRGIILTDSLTSQLIENVSIYRISYCTADKMHDKVFAYIAQSQQNESLECHAFLCTKRKVAQAVTLTVAQAFKVAFEFWQVSKEEKEKREKANQEGGDVPGTRRDSTPSLKTLVATGNLLDLEEVAKAPLSTVSANTNNVDETPRPQVLGNNSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLSAQDIHYAQCLSPTDWDKPDSSGIDQDDDVFTF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDALKSAG -------CHHHHHHH | 6.49 | - | |
14 | Phosphorylation | AGRALIRSPSLAKQS HHHHHHHCHHHHHCC | 16.31 | 26824392 | |
16 | Phosphorylation | RALIRSPSLAKQSWA HHHHHCHHHHHCCCC | 42.05 | 22942356 | |
19 | Ubiquitination | IRSPSLAKQSWAGGR HHCHHHHHCCCCCCC | 50.59 | 22790023 | |
194 | Phosphorylation | EGGDVPGTRRDSTPS CCCCCCCCCCCCCCC | 19.23 | 26239621 | |
198 | Phosphorylation | VPGTRRDSTPSLKTL CCCCCCCCCCCHHHH | 40.17 | 25521595 | |
199 | Phosphorylation | PGTRRDSTPSLKTLV CCCCCCCCCCHHHHH | 22.61 | 25521595 | |
201 | Phosphorylation | TRRDSTPSLKTLVAT CCCCCCCCHHHHHHH | 42.46 | 27087446 | |
204 | Phosphorylation | DSTPSLKTLVATGNL CCCCCHHHHHHHCCC | 31.58 | 22817900 | |
245 | Phosphorylation | PQVLGNNSVVWELDD CCCCCCCCEEEEECC | 23.27 | 30352176 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARH_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARH_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARH_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ARH_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry."; Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.; J. Proteome Res. 7:5314-5326(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-198, AND MASSSPECTROMETRY. | |
"Specific phosphopeptide enrichment with immobilized titanium ionaffinity chromatography adsorbent for phosphoproteome analysis."; Zhou H., Ye M., Dong J., Han G., Jiang X., Wu R., Zou H.; J. Proteome Res. 7:3957-3967(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-198, AND MASSSPECTROMETRY. |