UniProt ID | ARFRP_MOUSE | |
---|---|---|
UniProt AC | Q8BXL7 | |
Protein Name | ADP-ribosylation factor-related protein 1 | |
Gene Name | Arfrp1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 201 | |
Subcellular Localization | Golgi apparatus . Golgi apparatus, trans-Golgi network . Located in the trans-Golgi in the GTP-bound active state. | |
Protein Description | Trans-Golgi-associated GTPase that regulates protein sorting. Controls the targeting of ARL1 and its effector to the trans-Golgi. Required for the lipidation of chylomicrons in the intestine and required for VLDL lipidation in the liver.. | |
Protein Sequence | MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLSESKEAFEKVVSSEALDGVPILVLANKQDVETCLSIPDIKTAFSDCTCKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARFRP_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARFRP_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARFRP_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ARFRP_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...