ARFRP_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARFRP_MOUSE
• UniProt AC: Q8BXL7
• Protein Name: ADP-ribosylation factor-related protein 1
• Gene Name: Arfrp1
• Organism: Mus musculus (Mouse).
• Sequence Length: 201
• Subcellular Localization: Golgi apparatus . Golgi apparatus, trans-Golgi network . Located in the trans-Golgi in the GTP-bound active state.
• Protein Description: Trans-Golgi-associated GTPase that regulates protein sorting. Controls the targeting of ARL1 and its effector to the trans-Golgi. Required for the lipidation of chylomicrons in the intestine and required for VLDL lipidation in the liver..
• Protein Sequence: MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLSESKEAFEKVVSSEALDGVPILVLANKQDVETCLSIPDIKTAFSDCTCKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MYTLLSGL -------CCHHHHHH	5.35	-
3	Phosphorylation	-----MYTLLSGLYK -----CCHHHHHHHH	21.66	28576409

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARFRP_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARFRP_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARFRP_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of ARFRP_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.