| UniProt ID | ARFRP_HUMAN | |
|---|---|---|
| UniProt AC | Q13795 | |
| Protein Name | ADP-ribosylation factor-related protein 1 | |
| Gene Name | ARFRP1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 201 | |
| Subcellular Localization | Golgi apparatus . Golgi apparatus, trans-Golgi network . Located in the trans-Golgi in the GTP-bound active state. | |
| Protein Description | Trans-Golgi-associated GTPase that regulates protein sorting. Controls the targeting of ARL1 and its effector to the trans-Golgi. Required for the lipidation of chylomicrons in the intestine and required for VLDL lipidation in the liver.. | |
| Protein Sequence | MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MYTLLSGL -------CCHHHHHH | 5.35 | 22223895 | |
| 2 | Phosphorylation | ------MYTLLSGLY ------CCHHHHHHH | 13.19 | 20068231 | |
| 3 | Phosphorylation | -----MYTLLSGLYK -----CCHHHHHHHH | 21.66 | 20068231 | |
| 6 | Phosphorylation | --MYTLLSGLYKYMF --CCHHHHHHHHHHC | 29.84 | 20068231 | |
| 9 | Phosphorylation | YTLLSGLYKYMFQKD CHHHHHHHHHHCCCC | 12.00 | 20068231 | |
| 38 | Ubiquitination | TTFLEQSKTRFNKNY CCHHHHHHHCCCCCC | 43.33 | - | |
| 112 | Ubiquitination | EERLAESKQAFEKVV HHHHHHHHHHHHHHH | 36.83 | - | |
| 140 | Phosphorylation | ANKQDVETCLSIPDI CCCCCHHHHHCCCCH | 20.70 | 30622161 | |
| 143 | Phosphorylation | QDVETCLSIPDIKTA CCHHHHHCCCCHHHH | 33.93 | 30622161 | |
| 156 | Phosphorylation | TAFSDCTSKIGRRDC HHHHHHCHHCCCHHH | 28.71 | - | |
| 157 | Ubiquitination | AFSDCTSKIGRRDCL HHHHHCHHCCCHHHH | 30.90 | - | |
| 157 | Acetylation | AFSDCTSKIGRRDCL HHHHHCHHCCCHHHH | 30.90 | 25953088 | |
| 165 | Phosphorylation | IGRRDCLTQACSALT CCCHHHHHHHHHHHH | 22.05 | 27732954 | |
| 169 | Phosphorylation | DCLTQACSALTGKGV HHHHHHHHHHHCCCH | 29.36 | 27732954 | |
| 172 | Phosphorylation | TQACSALTGKGVREG HHHHHHHHCCCHHHH | 36.24 | 27732954 | |
| 174 | Ubiquitination | ACSALTGKGVREGIE HHHHHHCCCHHHHHH | 49.34 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARFRP_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARFRP_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARFRP_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ARFRP_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
