| UniProt ID | ARF5_MOUSE | |
|---|---|---|
| UniProt AC | P84084 | |
| Protein Name | ADP-ribosylation factor 5 | |
| Gene Name | Arf5 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 180 | |
| Subcellular Localization |
Golgi apparatus. Cytoplasm, perinuclear region. Membrane Lipid-anchor . |
|
| Protein Description | GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.. | |
| Protein Sequence | MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Myristoylation | ------MGLTVSALF ------CCCCHHHHH | 30.01 | - | |
| 4 | Phosphorylation | ----MGLTVSALFSR ----CCCCHHHHHHH | 13.49 | - | |
| 6 | Phosphorylation | --MGLTVSALFSRIF --CCCCHHHHHHHHH | 17.64 | - | |
| 10 | Phosphorylation | LTVSALFSRIFGKKQ CCHHHHHHHHHCCCC | 25.89 | - | |
| 35 | Phosphorylation | AGKTTILYKLKLGEI CCCEEEEEEEECCCE | 15.49 | - | |
| 36 | Ubiquitination | GKTTILYKLKLGEIV CCEEEEEEEECCCEE | 35.38 | 27667366 | |
| 38 | Ubiquitination | TTILYKLKLGEIVTT EEEEEEEECCCEEEE | 50.74 | - | |
| 59 | Ubiquitination | NVETVEYKNICFTVW CCEEEEEEEEEEEEE | 26.74 | - | |
| 109 | Ubiquitination | ESADELQKMLQEDEL HHHHHHHHHHCHHHH | 54.95 | 22790023 | |
| 142 | Ubiquitination | PVSELTDKLGLQHLR CHHHHHHHHCHHHHH | 38.94 | 22790023 | |
| 150 | Phosphorylation | LGLQHLRSRTWYVQA HCHHHHHHCCEEEEE | 40.18 | 29514104 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARF5_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARF5_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARF5_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ARF5_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
