UniProt ID | ARF3_MOUSE | |
---|---|---|
UniProt AC | P61205 | |
Protein Name | ADP-ribosylation factor 3 | |
Gene Name | Arf3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 181 | |
Subcellular Localization | Golgi apparatus. Cytoplasm, perinuclear region. | |
Protein Description | GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.. | |
Protein Sequence | MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGNIFGNLL ------CCCHHHHHH | 35.62 | - | |
15 | Ubiquitination | LLKSLIGKKEMRILM HHHHHCCCHHEEEEE | 38.27 | - | |
35 | Phosphorylation | AGKTTILYKLKLGEI CCCEEEEEEEECCCE | 15.49 | - | |
36 | Ubiquitination | GKTTILYKLKLGEIV CCEEEEEEEECCCEE | 35.38 | - | |
36 | Succinylation | GKTTILYKLKLGEIV CCEEEEEEEECCCEE | 35.38 | 23806337 | |
36 | Acetylation | GKTTILYKLKLGEIV CCEEEEEEEECCCEE | 35.38 | 23806337 | |
38 | Ubiquitination | TTILYKLKLGEIVTT EEEEEEEECCCEEEE | 50.74 | - | |
38 | Acetylation | TTILYKLKLGEIVTT EEEEEEEECCCEEEE | 50.74 | 22826441 | |
59 | Ubiquitination | NVETVEYKNISFTVW EEEEEEEEEEEEEEE | 34.01 | - | |
62 | Phosphorylation | TVEYKNISFTVWDVG EEEEEEEEEEEEECC | 25.02 | 22817900 | |
73 | Acetylation | WDVGGQDKIRPLWRH EECCCCCCCHHHHHH | 32.50 | 23806337 | |
73 | Ubiquitination | WDVGGQDKIRPLWRH EECCCCCCCHHHHHH | 32.50 | - | |
127 | Ubiquitination | VLLVFANKQDLPNAM HHHHEECCCCCCCCC | 41.58 | 22790023 | |
140 | Phosphorylation | AMNAAEITDKLGLHS CCCHHHHHHHHCCHH | 20.70 | 20415495 | |
142 | Ubiquitination | NAAEITDKLGLHSLR CHHHHHHHHCCHHCC | 35.49 | 22790023 | |
142 | Acetylation | NAAEITDKLGLHSLR CHHHHHHHHCCHHCC | 35.49 | 23236377 | |
147 | Phosphorylation | TDKLGLHSLRHRNWY HHHHCCHHCCCCCEE | 31.94 | 22942356 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARF3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARF3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARF3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ARF3_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...