ARF1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARF1_SCHPO
• UniProt AC: P36579
• Protein Name: ADP-ribosylation factor 1
• Gene Name: arf1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 180
• Subcellular Localization: Golgi apparatus.
• Protein Description: GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus..
• Protein Sequence: MGLSISKLFQSLFGKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYRNISFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRERISEAHEELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRHRQWYIQATCATSGDGLYEGLEWLSTNLKNQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGLSISKLF ------CCCCHHHHH	28.29	-
62	Phosphorylation	TVEYRNISFTVWDVG EEEEEEEEEEEEECC	20.58	25720772
147	Phosphorylation	TDKLGLHSLRHRQWY HHHHCCHHHHCCCEE	31.94	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARF1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARF1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARF1_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of ARF1_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.