ARF1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARF1_ARATH
• UniProt AC: P36397
• Protein Name: ADP-ribosylation factor 1
• Gene Name: ARF1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 181
• Subcellular Localization: Golgi apparatus. Endosome.
• Protein Description: GTP-binding protein involved in protein trafficking; required for the sequence-specific vacuolar sorting route to the lytic vacuole, for the ER-to-Golgi transport and for the Golgi-derived transport to the plasma membrane. Involved in the recruitment of COPI and GDAP1 to membranes..
• Protein Sequence: MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGLSFGKLF ------CCCCHHHHH	29.99	-
4	Phosphorylation	----MGLSFGKLFSR ----CCCCHHHHHHH	26.65	19880383
10	Phosphorylation	LSFGKLFSRLFAKKE CCHHHHHHHHHCHHC	38.21	19880383
147	Phosphorylation	TDKLGLHSLRQRHWY HHHHCCHHHHHCCEE	30.23	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARF1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARF1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARF1_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of ARF1_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.