ARF12_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARF12_CAEEL
• UniProt AC: Q10943
• Protein Name: ADP-ribosylation factor 1-like 2
• Gene Name: arf-1.2
• Organism: Caenorhabditis elegans.
• Sequence Length: 181
• Subcellular Localization: Golgi apparatus.
• Protein Description: GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus. Involved in endoplasmic reticulum dynamics during embryogenesis. [PubMed: 15716356 Also required for adult germline function]
• Protein Sequence: MGNVFGSLFKGLFGKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSNQLKNRS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGNVFGSLF ------CCCHHHHHH	38.72	-
62	Phosphorylation	TVEYKNISFTVWDVG EEEEEEEEEEEEECC	25.02	30078680
147	Phosphorylation	TDKLGLHSLRNRSWY HHHHCHHHCCCCCEE	33.78	28854356

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARF12_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARF12_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARF12_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KLHL8_CAEEL	kel-8	physical	14992718

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.