AREH1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AREH1_SCHPO
• UniProt AC: Q10269
• Protein Name: Probable sterol O-acyltransferase 1
• Gene Name: are1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 537
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Sequence: MTDTPRILITPSPLSDISTTINKPNVHPSMSLLKALPECRLVVKSKGDKNNANVVEFPLDRHKQLLIAGKVYHDYKFKPRKSIFDRVTDPNYFAKSEFRGFYVLFWLSMAAWVLQLYARSYWQRDTLLGLPLARQVFRQFFVLFSSDFLMICLSFFSYGLQVCIEKNMIRWANLGYTIQTLWQGFYMVLAVYWVKHRDFPIVQCVFFTLHCAVLIMKQFSYSHHMGYISEIRILHNEYEKLLKFVRECLNSTEKDEKYTFELTFPNKPAETISTLQAEEIVALTAKYLSRQMRSEVGNVVYPDNINFFNYVDYLLVPSLVYSMEFPRVAHFRWHYMAFKAGSTFGLLALTLALVDWYFVPSAVAVKDLDFIGKLRIAPLLMNKIMFPAIILYLIMFYLIFDCILNAFAEITKFADRGFYGAWWNTVTWDEFSREWNKPVHVFLMRHVYHSSISGFKLKKSHAVLLTFLISALVHEFVMLLATGKFRCYILTFQLLQIPLYDLQQMFAFKKRDILGNVFFWIGMFTGPSFLCILYIVF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTDTPRILI ------CCCCCEEEE	48.89	21712547
12	Phosphorylation	PRILITPSPLSDIST CEEEECCCCHHHCCC	29.80	21712547
250	N-linked_Glycosylation	KFVRECLNSTEKDEK HHHHHHHCCCCCCCC	59.55	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AREH1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AREH1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AREH1_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of AREH1_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.