ARD1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARD1_SCHPO
• UniProt AC: Q9UTI3
• Protein Name: N-terminal acetyltransferase A complex catalytic subunit ard1
• Gene Name: ard1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 177
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala. N-acetylation plays a role in normal eukaryotic translation and processing, protect against proteolytic degradation and protein turnover..
• Protein Sequence: MDIRPARISDLTGMQNCNLHNLPENYQLKYYLYHAISWPMLSYVATDPKGRVVGYVLAKMEEEPKDGIPHGHITSVSVMRSYRHLGLAKRLMVQSQRAMVEVYGAKYMSLHVRKSNRAAIHLYRDTLQFDVQGIESKYYADGEDAYAMHKDFSTLKFDTPETNDELAKTVQSLALNN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
153	Phosphorylation	YAMHKDFSTLKFDTP EEECCCCCCCCCCCC	42.85	25720772
159	Phosphorylation	FSTLKFDTPETNDEL CCCCCCCCCCCCHHH	26.59	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARD1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARD1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARD1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NAT1_SCHPO	naa15	physical	23912279

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.