UniProt ID | AR6P4_MOUSE | |
---|---|---|
UniProt AC | Q9JM93 | |
Protein Name | ADP-ribosylation factor-like protein 6-interacting protein 4 | |
Gene Name | Arl6ip4 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 229 | |
Subcellular Localization | Nucleus, nucleolus. Nucleus speckle. | |
Protein Description | Involved in modulating alternative pre-mRNA splicing with either 5' distal site activation or preferential use of 3' proximal site.. | |
Protein Sequence | MAHVGSRKRSRSRSRSRSGRRGSEKRSKRSSKDASRNCSASRSQGHKAGSASGVEERSKHKAQRTSRSSSTSSSSSSSSSASSSSSSDGRKKRAKHKEKKRKKKKKKRKKKLKKRVKEKAVAVHQAEALPGPSLDQWHRSAGEDNDGPVLTDEQKSRIQAMKPMTKEEWDARQSVIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDGLAFQMRTGLLP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MAHVGSRKRSRSR --CCCCCCCCCHHHC | 33.27 | 24719451 | |
50 | Phosphorylation | SQGHKAGSASGVEER HHCCCCCCCCCHHHH | 24.91 | 25521595 | |
52 | Phosphorylation | GHKAGSASGVEERSK CCCCCCCCCHHHHHH | 45.10 | 23684622 | |
133 | Phosphorylation | AEALPGPSLDQWHRS HHCCCCCCHHHHHHH | 50.96 | 26745281 | |
140 | Phosphorylation | SLDQWHRSAGEDNDG CHHHHHHHCCCCCCC | 27.95 | 26824392 | |
151 | Phosphorylation | DNDGPVLTDEQKSRI CCCCCCCCHHHHHHH | 37.41 | 25619855 | |
174 | Phosphorylation | EEWDARQSVIRKVVD HHHHHHHHHHHHHCC | 17.60 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AR6P4_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AR6P4_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AR6P4_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of AR6P4_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Protein phosphorylation and expression profiling by Yin-yangmultidimensional liquid chromatography (Yin-yang MDLC) massspectrometry."; Dai J., Jin W.-H., Sheng Q.-H., Shieh C.-H., Wu J.-R., Zeng R.; J. Proteome Res. 6:250-262(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-140, AND MASSSPECTROMETRY. |