APR_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: APR_MOUSE
• UniProt AC: Q9JM54
• Protein Name: Phorbol-12-myristate-13-acetate-induced protein 1
• Gene Name: Pmaip1
• Organism: Mus musculus (Mouse).
• Sequence Length: 103
• Subcellular Localization: Mitochondrion .
• Protein Description: Promotes activation of caspases and apoptosis. Promotes mitochondrial membrane changes and efflux of apoptogenic proteins from the mitochondria. Contributes to p53/TP53-dependent apoptosis after radiation exposure. Promotes proteasomal degradation of MCL1. Competes with BIM/BCL2L11 for binding to MCL1 and can displace BIM/BCL2L11 from its binding site on MCL1 (By similarity). Competes with BAK1 for binding to MCL1 and can displace BAK1 from its binding site on MCL1..
• Protein Sequence: MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
61	Phosphorylation	SQKSRMRSPSPTRVP CHHHCCCCCCCCCCC	22.01	23384938
63	Phosphorylation	KSRMRSPSPTRVPAD HHCCCCCCCCCCCCC	39.90	24899341
65	Phosphorylation	RMRSPSPTRVPADLK CCCCCCCCCCCCCHH	48.95	22942356
97	Ubiquitination	KLLNLISKLFNLVT- HHHHHHHHHHCCCC-	50.53	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of APR_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of APR_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of APR_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of APR_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.