| UniProt ID | APOE_RAT | |
|---|---|---|
| UniProt AC | P02650 | |
| Protein Name | Apolipoprotein E | |
| Gene Name | Apoe | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 312 | |
| Subcellular Localization | Secreted . | |
| Protein Description | Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.. | |
| Protein Sequence | MKALWALLLVPLLTGCLAEGELEVTDQLPGQSDQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTVLMEDTMTEVKAYKKELEEQLGPVAEETRARLAKEVQAAQARLGADMEDLRNRLGQYRNEVNTMLGQSTEELRSRLSTHLRKMRKRLMRDADDLQKRLAVYKAGAQEGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQALSDRIRGRLEEVGNQARDRLEEVREQMEEVRSKMEEQTQQIRLQAEIFQARIKGWFEPLVEDMQRQWANLMEKIQASVATNSIASTTVPLENQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 105 | Ubiquitination | ETRARLAKEVQAAQA HHHHHHHHHHHHHHH | 64.11 | - | |
| 134 | Phosphorylation | QYRNEVNTMLGQSTE HHHHHHHHHHCCCHH | 20.96 | 28551015 | |
| 135 | Methionine sulfoxide | YRNEVNTMLGQSTEE HHHHHHHHHCCCHHH | 3.14 | - | |
| 135 | Oxidation | YRNEVNTMLGQSTEE HHHHHHHHHCCCHHH | 3.14 | - | |
| 139 | Phosphorylation | VNTMLGQSTEELRSR HHHHHCCCHHHHHHH | 35.67 | 29779826 | |
| 140 | Phosphorylation | NTMLGQSTEELRSRL HHHHCCCHHHHHHHH | 26.12 | 27097102 | |
| 145 | Phosphorylation | QSTEELRSRLSTHLR CCHHHHHHHHHHHHH | 50.64 | 23984901 | |
| 252 | Acetylation | QMEEVRSKMEEQTQQ HHHHHHHHHHHHHHH | 39.50 | 22902405 | |
| 252 | Ubiquitination | QMEEVRSKMEEQTQQ HHHHHHHHHHHHHHH | 39.50 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of APOE_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of APOE_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of APOE_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of APOE_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
