dbPTM

APOE_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	APOE_MOUSE
UniProt AC	P08226
Protein Name	Apolipoprotein E
Gene Name	Apoe
Organism	Mus musculus (Mouse).
Sequence Length	311
Subcellular Localization	Secreted .
Protein Description	Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues..
Protein Sequence	MKALWAVLLVTLLTGCLAEGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
86	Ubiquitination	TEVKAYKKELEEQLG HHHHHHHHHHHHHHC	55.65	22790023
105	Ubiquitination	ETRARLGKEVQAAQA HHHHHHHHHHHHHHH	60.34	22790023
134	Phosphorylation	QYRNEVHTMLGQSTE HHHHHHHHHHCCCHH	21.19	29472430
135	Methionine sulfoxide	YRNEVHTMLGQSTEE HHHHHHHHHCCCHHH	2.09	-
135	Oxidation	YRNEVHTMLGQSTEE HHHHHHHHHCCCHHH	2.09	16876491
139	Phosphorylation	VHTMLGQSTEEIRAR HHHHHCCCHHHHHHH	35.67	25521595
140	Phosphorylation	HTMLGQSTEEIRARL HHHHCCCHHHHHHHH	29.74	25521595
148	Phosphorylation	EEIRARLSTHLRKMR HHHHHHHHHHHHHHH	14.29	23737553
149	Phosphorylation	EIRARLSTHLRKMRK HHHHHHHHHHHHHHH	29.53	23737553
173	Ubiquitination	QKRLAVYKAGAREGA HHHHHHHHHHHHHHH	33.47	22790023
202	Phosphorylation	VEQGRQRTANLGAGA HHHHCHHHHCCCCCC	16.14	28059163
252	Ubiquitination	HMEEVRSKMEEQTQQ HHHHHHHHHHHHHHH	39.50	22790023
272	Ubiquitination	EIFQARLKGWFEPIV HHHHHHHCHHCHHHH	48.84	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of APOE_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of APOE_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of APOE_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
SET_MOUSE	Set	physical	21289314

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of APOE_MOUSE

Related Literatures of Post-Translational Modification