UniProt ID | APOA2_MOUSE | |
---|---|---|
UniProt AC | P09813 | |
Protein Name | Apolipoprotein A-II | |
Gene Name | Apoa2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 102 | |
Subcellular Localization | Secreted . | |
Protein Description | May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism.. | |
Protein Sequence | MKLLAMVALLVTICSLEGALVKRQADGPDMQSLFTQYFQSMTDYGKDLMEKAKTSEIQSQAKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPAPAAK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 | Pyrrolidone_carboxylic_acid | EGALVKRQADGPDMQ HHHHHHHCCCCCCHH | 37.78 | - | |
49 | Methionine sulfoxide | TDYGKDLMEKAKTSE HHHHHHHHHHHHHHH | 11.55 | - | |
49 | Oxidation | TDYGKDLMEKAKTSE HHHHHHHHHHHHHHH | 11.55 | - | |
51 | Ubiquitination | YGKDLMEKAKTSEIQ HHHHHHHHHHHHHHH | 47.94 | 22790023 | |
51 | Ubiquitination | YGKDLMEKAKTSEIQ HHHHHHHHHHHHHHH | 47.94 | 22790023 | |
53 | Ubiquitination | KDLMEKAKTSEIQSQ HHHHHHHHHHHHHHH | 64.75 | 27667366 | |
59 | Phosphorylation | AKTSEIQSQAKAYFE HHHHHHHHHHHHHHH | 42.47 | 24719451 | |
62 | Ubiquitination | SEIQSQAKAYFEKTH HHHHHHHHHHHHHHH | 29.72 | - | |
62 | Ubiquitination | SEIQSQAKAYFEKTH HHHHHHHHHHHHHHH | 29.72 | 22790023 | |
62 | Succinylation | SEIQSQAKAYFEKTH HHHHHHHHHHHHHHH | 29.72 | 23954790 | |
67 | Acetylation | QAKAYFEKTHEQLTP HHHHHHHHHHHHHHH | 45.33 | 21728379 | |
67 | Ubiquitination | QAKAYFEKTHEQLTP HHHHHHHHHHHHHHH | 45.33 | 22790023 | |
67 | Ubiquitination | QAKAYFEKTHEQLTP HHHHHHHHHHHHHHH | 45.33 | 22790023 | |
73 | Phosphorylation | EKTHEQLTPLVRSAG HHHHHHHHHHHHHHC | 17.80 | 24719451 | |
81 | Phosphorylation | PLVRSAGTSLVNFFS HHHHHHCHHHHHHHH | 20.71 | 25338131 | |
82 | Phosphorylation | LVRSAGTSLVNFFSS HHHHHCHHHHHHHHH | 29.42 | 25338131 | |
88 | Phosphorylation | TSLVNFFSSLMNLEE HHHHHHHHHHCCCCC | 20.58 | 25338131 | |
89 | Phosphorylation | SLVNFFSSLMNLEEK HHHHHHHHHCCCCCC | 26.87 | 25338131 | |
96 | Ubiquitination | SLMNLEEKPAPAAK- HHCCCCCCCCCCCC- | 36.78 | 22790023 | |
96 | Ubiquitination | SLMNLEEKPAPAAK- HHCCCCCCCCCCCC- | 36.78 | 22790023 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of APOA2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of APOA2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of APOA2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of APOA2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...