| UniProt ID | APOA2_MOUSE | |
|---|---|---|
| UniProt AC | P09813 | |
| Protein Name | Apolipoprotein A-II | |
| Gene Name | Apoa2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 102 | |
| Subcellular Localization | Secreted . | |
| Protein Description | May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism.. | |
| Protein Sequence | MKLLAMVALLVTICSLEGALVKRQADGPDMQSLFTQYFQSMTDYGKDLMEKAKTSEIQSQAKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPAPAAK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 24 | Pyrrolidone_carboxylic_acid | EGALVKRQADGPDMQ HHHHHHHCCCCCCHH | 37.78 | - | |
| 49 | Methionine sulfoxide | TDYGKDLMEKAKTSE HHHHHHHHHHHHHHH | 11.55 | - | |
| 49 | Oxidation | TDYGKDLMEKAKTSE HHHHHHHHHHHHHHH | 11.55 | - | |
| 51 | Ubiquitination | YGKDLMEKAKTSEIQ HHHHHHHHHHHHHHH | 47.94 | 22790023 | |
| 51 | Ubiquitination | YGKDLMEKAKTSEIQ HHHHHHHHHHHHHHH | 47.94 | 22790023 | |
| 53 | Ubiquitination | KDLMEKAKTSEIQSQ HHHHHHHHHHHHHHH | 64.75 | 27667366 | |
| 59 | Phosphorylation | AKTSEIQSQAKAYFE HHHHHHHHHHHHHHH | 42.47 | 24719451 | |
| 62 | Ubiquitination | SEIQSQAKAYFEKTH HHHHHHHHHHHHHHH | 29.72 | - | |
| 62 | Ubiquitination | SEIQSQAKAYFEKTH HHHHHHHHHHHHHHH | 29.72 | 22790023 | |
| 62 | Succinylation | SEIQSQAKAYFEKTH HHHHHHHHHHHHHHH | 29.72 | 23954790 | |
| 67 | Acetylation | QAKAYFEKTHEQLTP HHHHHHHHHHHHHHH | 45.33 | 21728379 | |
| 67 | Ubiquitination | QAKAYFEKTHEQLTP HHHHHHHHHHHHHHH | 45.33 | 22790023 | |
| 67 | Ubiquitination | QAKAYFEKTHEQLTP HHHHHHHHHHHHHHH | 45.33 | 22790023 | |
| 73 | Phosphorylation | EKTHEQLTPLVRSAG HHHHHHHHHHHHHHC | 17.80 | 24719451 | |
| 81 | Phosphorylation | PLVRSAGTSLVNFFS HHHHHHCHHHHHHHH | 20.71 | 25338131 | |
| 82 | Phosphorylation | LVRSAGTSLVNFFSS HHHHHCHHHHHHHHH | 29.42 | 25338131 | |
| 88 | Phosphorylation | TSLVNFFSSLMNLEE HHHHHHHHHHCCCCC | 20.58 | 25338131 | |
| 89 | Phosphorylation | SLVNFFSSLMNLEEK HHHHHHHHHCCCCCC | 26.87 | 25338131 | |
| 96 | Ubiquitination | SLMNLEEKPAPAAK- HHCCCCCCCCCCCC- | 36.78 | 22790023 | |
| 96 | Ubiquitination | SLMNLEEKPAPAAK- HHCCCCCCCCCCCC- | 36.78 | 22790023 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of APOA2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of APOA2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of APOA2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of APOA2_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...