UniProt ID | APLD1_HUMAN | |
---|---|---|
UniProt AC | Q96LR9 | |
Protein Name | Apolipoprotein L domain-containing protein 1 | |
Gene Name | APOLD1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 279 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein . |
|
Protein Description | May be involved in angiogenesis. May play a role in activity-dependent changes of brain vasculature. May affect blood-brain permeability.. | |
Protein Sequence | MFRAPCHRLRARGTRKARAGAWRGCTFPCLGKGMERPAAREPHGPDALRRFQGLLLDRRGRLHGQVLRLREVARRLERLRRRSLVANVAGSSLSATGALAAIVGLSLSPVTLGTSLLVSAVGLGVATAGGAVTITSDLSLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASIALYNSVYFIVFFGSRGFLIPRRAEGDTKVSQAVLKAKIQKLAESLESCTGALDELSEQLESRVQLCTKSSRGHDLKISADQRAGLFF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
133 | O-linked_Glycosylation | ATAGGAVTITSDLSL CCCCCEEEECCCCEE | 20.29 | OGP | |
135 | O-linked_Glycosylation | AGGAVTITSDLSLIF CCCEEEECCCCEEEE | 13.56 | OGP | |
136 | O-linked_Glycosylation | GGAVTITSDLSLIFC CCEEEECCCCEEEEE | 32.48 | OGP | |
260 | Ubiquitination | SRVQLCTKSSRGHDL HHHHHHHHCCCCCCC | 45.50 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of APLD1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of APLD1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of APLD1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of APLD1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...