UniProt ID | AP3S1_MOUSE | |
---|---|---|
UniProt AC | Q9DCR2 | |
Protein Name | AP-3 complex subunit sigma-1 | |
Gene Name | Ap3s1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 193 | |
Subcellular Localization |
Golgi apparatus. Cytoplasmic vesicle membrane Peripheral membrane protein Cytoplasmic side. Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.. |
|
Protein Description | Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.. | |
Protein Sequence | MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
18 | Ubiquitination | HGKPRLSKFYQPYSE CCCCCHHHCCCCCCH | 53.32 | - | |
132 | Phosphorylation | MGGMVLETNMNEIVT HCCEEEECCHHHHHH | 35.29 | - | |
139 | Phosphorylation | TNMNEIVTQIDAQNK CCHHHHHHHHHHHHH | 26.01 | - | |
150 | Phosphorylation | AQNKLEKSEAGLAGA HHHHHHHCHHHHCCC | 24.25 | 22817900 | |
163 | Phosphorylation | GAPARAVSAVKNMNL CCCHHHHHHHHCCCC | 26.76 | 22817900 | |
166 | Ubiquitination | ARAVSAVKNMNLPEI HHHHHHHHCCCCCCC | 50.63 | - | |
183 | Phosphorylation | NINIGDISIKVPNLP CCEECCCEEECCCCC | 22.54 | 23984901 | |
185 | Ubiquitination | NIGDISIKVPNLPSF EECCCEEECCCCCCC | 44.86 | - | |
191 | Phosphorylation | IKVPNLPSFK----- EECCCCCCCC----- | 49.16 | 26745281 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AP3S1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AP3S1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AP3S1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of AP3S1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...