AP1S3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AP1S3_HUMAN
• UniProt AC: Q96PC3
• Protein Name: AP-1 complex subunit sigma-3
• Gene Name: AP1S3
• Organism: Homo sapiens (Human).
• Sequence Length: 154
• Subcellular Localization: Golgi apparatus. Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Membrane, clathrin-coated pit. Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.
• Protein Description: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Involved in TLR3 trafficking. [PubMed: 24791904]
• Protein Sequence: MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNVCELDIIFNFEKAYFILDEFIIGGEIQETSKKIAVKAIEDSDMLQEVSTVSQTMGER

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
47	Phosphorylation	LSRGHRTSSFVDWKE HHCCCCCCCCCCHHH	23.03	23312004
56	Ubiquitination	FVDWKELKLVYKRYA CCCHHHHHHHHHHHH	36.68	29967540
64	Phosphorylation	LVYKRYASLYFCCAI HHHHHHHHHHEEEEE	18.05	22150273
87	Phosphorylation	TLEIVHRYVELLDKY HHHHHHHHHHHHHHH	5.38	-
133	Ubiquitination	TSKKIAVKAIEDSDM HCCHHHHEHHCCCHH	34.33	21906983
133 (in isoform 4)	Ubiquitination	-	34.33	-
144 (in isoform 4)	Phosphorylation	-	3.61	26503514
148 (in isoform 4)	Phosphorylation	-	21.74	26503514

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AP1S3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AP1S3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AP1S3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AAKG1_HUMAN	PRKAG1	physical	21988832

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.