UniProt ID | ANXA5_RAT | |
---|---|---|
UniProt AC | P14668 | |
Protein Name | Annexin A5 | |
Gene Name | Anxa5 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 319 | |
Subcellular Localization | ||
Protein Description | This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.. | |
Protein Sequence | MALRGTVTDFSGFDGRADAEVLRKAMKGLGTDEDSILNLLTARSNAQRQQIAEEFKTLFGRDLVNDMKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELRAIKQAYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITILGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLENLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVIVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGEDD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MALRGTVTD ------CCCCCEEEC | 13.13 | 7583670 | |
11 | Phosphorylation | RGTVTDFSGFDGRAD CCEEECCCCCCCCHH | 41.16 | 28432305 | |
27 | Acetylation | EVLRKAMKGLGTDED HHHHHHHCCCCCCHH | 56.71 | 22902405 | |
31 | Phosphorylation | KAMKGLGTDEDSILN HHHCCCCCCHHHHHH | 41.06 | 22673903 | |
35 | Phosphorylation | GLGTDEDSILNLLTA CCCCCHHHHHHHHHH | 27.25 | 22673903 | |
41 | Phosphorylation | DSILNLLTARSNAQR HHHHHHHHHCCHHHH | 24.16 | 24259510 | |
56 | Acetylation | QQIAEEFKTLFGRDL HHHHHHHHHHHCHHH | 47.82 | 22902405 | |
68 | Acetylation | RDLVNDMKSELTGKF HHHHHHHHHHHCCHH | 43.58 | 22902405 | |
74 | Acetylation | MKSELTGKFEKLIVA HHHHHCCHHHHHHHH | 45.15 | 22902405 | |
77 | Acetylation | ELTGKFEKLIVALMK HHCCHHHHHHHHHHC | 46.80 | 22902405 | |
84 | Acetylation | KLIVALMKPSRLYDA HHHHHHHCHHHHHHH | 40.46 | 22902405 | |
92 | Phosphorylation | PSRLYDAYELKHALK HHHHHHHHHHHHHHC | 20.92 | 22108457 | |
95 | Acetylation | LYDAYELKHALKGAG HHHHHHHHHHHCCCC | 18.19 | 22902405 | |
99 | Acetylation | YELKHALKGAGTDEK HHHHHHHCCCCCCHH | 47.72 | 22902405 | |
106 | Ubiquitination | KGAGTDEKVLTEIIA CCCCCCHHHHHHHHH | 45.41 | - | |
106 | Acetylation | KGAGTDEKVLTEIIA CCCCCCHHHHHHHHH | 45.41 | 22902405 | |
109 | Phosphorylation | GTDEKVLTEIIASRT CCCHHHHHHHHHCCC | 28.29 | 23984901 | |
191 | Acetylation | KWGTDEEKFITILGT CCCCCHHHEEEEEEC | 39.76 | 22902405 | |
200 | Phosphorylation | ITILGTRSVSHLRRV EEEEECCCHHHHHHH | 28.01 | 22673903 | |
202 | Phosphorylation | ILGTRSVSHLRRVFD EEECCCHHHHHHHHH | 20.32 | 22673903 | |
240 | Acetylation | NLLLAVVKSIRSIPA HHHHHHHHHHHCCHH | 33.30 | 22902405 | |
258 | Acetylation | ETLYYAMKGAGTDDH HHHHHHHHCCCCCCC | 37.12 | 22902405 | |
288 | Succinylation | NIRKEFRKNFATSLY HHCHHHHHHHHHHHH | 62.83 | - | |
288 | Succinylation | NIRKEFRKNFATSLY HHCHHHHHHHHHHHH | 62.83 | - | |
299 | Acetylation | TSLYSMIKGDTSGDY HHHHHHHHCCCCCCH | 41.93 | 22902405 | |
307 | Acetylation | GDTSGDYKKALLLLC CCCCCCHHHEEHHHC | 35.99 | 22902405 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ANXA5_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ANXA5_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ANXA5_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ANXA5_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...