ANRA2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ANRA2_MOUSE
• UniProt AC: Q99PE2
• Protein Name: Ankyrin repeat family A protein 2
• Gene Name: Ankra2
• Organism: Mus musculus (Mouse).
• Sequence Length: 312
• Subcellular Localization: Cytoplasm, cytoskeleton . Membrane ; Peripheral membrane protein .
• Protein Description: May regulate the interaction between the 3M complex and the histone deacetylases HDAC4 and HDAC5 (By similarity). May also regulate LRP2/megalin. [PubMed: 11095640]
• Protein Sequence: MATSANLDIGAQLIVEECPSSYISGMPDIKLEHQLDPNPDEGAAQGVAMGMKFILPNRFDMNVCSRFVKSLNEEDSKNIQDQVNSDLEVASVLFKAECNIHTSPSPGIQVRHVYTPSTTKHFSPIKQSTTLTNKHRGNEVSTTPLLANSLSAHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLENGADPTIETDSGYNSMDLAVALGYRGVQQAIESHLLKLLQNIRE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
102	Phosphorylation	KAECNIHTSPSPGIQ EEECCCCCCCCCCCE	38.24	30482847
105	Phosphorylation	CNIHTSPSPGIQVRH CCCCCCCCCCCEEEE	35.21	27566939
115	Phosphorylation	IQVRHVYTPSTTKHF CEEEEEECCCCCCCC	15.07	72254241
123	Phosphorylation	PSTTKHFSPIKQSTT CCCCCCCCCCCCCCC	25.99	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ANRA2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ANRA2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ANRA2_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of ANRA2_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.