UniProt ID | ANR49_MOUSE | |
---|---|---|
UniProt AC | Q8VE42 | |
Protein Name | Ankyrin repeat domain-containing protein 49 | |
Gene Name | Ankrd49 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 238 | |
Subcellular Localization | Nucleus . | |
Protein Description | May have a role in spermatogenesis where it promotes autophagy in response to serum starvation, via the NF-kappaB pathway.. | |
Protein Sequence | MEKEKKDDEKPDLENSVDFSEQFNQLELLKTHGHLIPTGTQSLWVGNSDEDEEQEEKNEEWYQLQEKKMEKDPSKLLLWAAEKNRLATVQRLLSEKAAEVNTRDEDEYTPLHRAAYSGHIDVVRELVAKGADVHAVTVDGWTPLHSACKWNNTKVASFLLQHDADINAQTKGLLTPLHLAAGNRDSRDTLELLLMNRYIKPELKNNSQETASDIARRTSIYHYLFEIAEGCTNSSPPS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | EKPDLENSVDFSEQF CCCCHHHCCCHHHHH | 17.43 | 25619855 | |
48 | Phosphorylation | QSLWVGNSDEDEEQE CEEECCCCCCCHHHH | 36.13 | 27180971 | |
62 | Phosphorylation | EEKNEEWYQLQEKKM HHHHHHHHHHHHHHC | 11.56 | 25293948 | |
198 | Phosphorylation | ELLLMNRYIKPELKN HHHHHHHHCCHHHCC | 14.32 | 25521595 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ANR49_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ANR49_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ANR49_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ANR49_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry."; Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.; J. Proteome Res. 7:5314-5326(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-48, AND MASSSPECTROMETRY. |