ANR46_RAT - dbPTM
ANR46_RAT - PTM Information in dbPTM
Basic Information of Protein
UniProt ID ANR46_RAT
UniProt AC Q76K24
Protein Name Ankyrin repeat domain-containing protein 46
Gene Name Ankrd46
Organism Rattus norvegicus (Rat).
Sequence Length 228
Subcellular Localization Membrane
Single-pass membrane protein .
Protein Description
Protein Sequence MSYVFVNDSSQTNVPLLQACIDGDFTYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGADPLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRLLESLEEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFRTTWQEFVEDLGFWRVLLLILVIALLSLGIAYYVSGVLPFVDNQPGLVH
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster
137UbiquitinationSLEEQEVKGFNRGTH
HHHHHHCCCCCCCCH
57.96-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of ANR46_RAT !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of ANR46_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of ANR46_RAT !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of ANR46_RAT !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of ANR46_RAT

loading...

Related Literatures of Post-Translational Modification

TOP