| UniProt ID | ANR42_HUMAN | |
|---|---|---|
| UniProt AC | Q8N9B4 | |
| Protein Name | Ankyrin repeat domain-containing protein 42 | |
| Gene Name | ANKRD42 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 389 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MPGVANSGPSTSSRETANPCSRKKVHFGSIHDAVRAGDVKQLSEIVCLHWLLWHGADITHVTTRGWTASHIAAIRGQDACVQALIMNGANLTAQDDRGCTPLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLLVKWGCSIEDVDYNGNLPVHLAAMEGHLHCFKFLVSRMSSATQVLKAFNDNGENVLDLAQRFFKQNILQFIQGAEYEGKDLEDQETLAFPGHVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQGHIECLQWLIKMGADSNITNKAGERPSDVAKRFAHLAAVKLLEELQKYDIDDENEIDENDVKYFIRHGVEGSTDAKDDLCLSDLDKTDARRPSKNCRASWSMNDYVEKN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 24 | Ubiquitination | ANPCSRKKVHFGSIH CCCCCCCCEECCCHH | 39.57 | - | |
| 40 | Ubiquitination | AVRAGDVKQLSEIVC HHHCCCHHHHHHHHH | 50.70 | - | |
| 40 (in isoform 2) | Ubiquitination | - | 50.70 | 21906983 | |
| 69 | Phosphorylation | TTRGWTASHIAAIRG ECCCCCHHHHHHHCC | 14.19 | 25219547 | |
| 129 | Ubiquitination | VDPSVTDKREWRPVH CCCCCCCCCCCCCCC | 42.74 | 2190698 | |
| 129 (in isoform 1) | Ubiquitination | - | 42.74 | 21906983 | |
| 157 (in isoform 2) | Ubiquitination | - | 6.44 | 21906983 | |
| 188 | Phosphorylation | KFLVSRMSSATQVLK HHHHHHHCHHHHHHH | 18.73 | 30622161 | |
| 189 | Phosphorylation | FLVSRMSSATQVLKA HHHHHHCHHHHHHHH | 26.45 | 30622161 | |
| 191 | Phosphorylation | VSRMSSATQVLKAFN HHHHCHHHHHHHHHC | 22.59 | 30622161 | |
| 328 | Phosphorylation | LLEELQKYDIDDENE HHHHHHCCCCCCCCC | 12.74 | 22703 | |
| 385 | Phosphorylation | ASWSMNDYVEKN--- CCCCHHHHHCCC--- | 12.90 | 7459915 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ANR42_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ANR42_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ANR42_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ANR42_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
