dbPTM

ANM15_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ANM15_ARATH
UniProt AC	Q8GWT4
Protein Name	Protein arginine N-methyltransferase 1.5
Gene Name	PMRT15
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	642
Subcellular Localization	Cytoplasm.
Protein Description	Methylates arginine residues of myelin basic protein (MBP) in vitro. Methylates symmetrically histone H4 of the FLC chromatin to form H4R3me2s, which in turn suppresses FLC expression to induce flowering. Regulates alternative splicing by methylating spliceosomal proteins. Involved in the post-transcriptional regulation of the circadian clock..
Protein Sequence	MPLGERGGWERTESRYCGVETDFSNDVTHLLNFNISTGGFDYVLAPLVDPSYRPSLVEGNGVDTQVLPVCGSDLVLSPSQWSSHVVGKISSWIDLDSEDEVLRMDSETTLKQEIAWATHLSLQACLLPTPKGKSCANYARCVNQILQGLTTLQLWLRVPLVKSEGDSMDDTSEGLNDSWELWNSFRLLCEHDSKLSVALDVLSTLPSETSLGRWMGESVRAAILSTDAFLTNARGYPCLSKRHQKLIAGFFDHAAQVVICGKPVHNLQKPLDSSSEGTEKNPLRIYLDYVAYLFQKMESLSEQERIELGYRDFLQAPLQPLMDNLEAQTYETFERDSVKYIQYQRAVEKALVDRVPDEKASELTTVLMVVGAGRGPLVRASLQAAEETDRKLKVYAVEKNPNAVVTLHNLVKMEGWEDVVTIISCDMRFWNAPEQADILVSELLGSFGDNELSPECLDGAQRFLKPDGISIPSSYTSFIQPITASKLYNDVKAHKDLAHFETAYVVKLHSVAKLAPSQSVFTFTHPNFSTKVNNQRYKKLQFSLPSDAGSALVHGFAGYFDSVLYKDVHLGIEPTTATPNMFSWFPIFFPLRKPVEVHPDTPLEVHFWRCCGSSKVWYEWSVSSPTPSPMHNTNGRSYWVGL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of ANM15_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ANM15_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ANM15_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ANM15_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ANM15_ARATH

Related Literatures of Post-Translational Modification