dbPTM

ANKUB_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ANKUB_HUMAN
UniProt AC	A6NFN9
Protein Name	Protein ANKUB1
Gene Name	ANKUB1
Organism	Homo sapiens (Human).
Sequence Length	502
Subcellular Localization
Protein Description
Protein Sequence	MRIFIAFEGSFEPFDVSADETVEVVKLMIKDYFHIPLSEDKQGRRYLELMYAGAALKDSWSLADVGISFCSTLKCFVKEEDKPTLYVFNAVTQDTMPVMESISLLDKTVSDLRTLVTLRCGLPVSVYCLRTPRGLEMYDCNTLKDYQTDIGTTLRLDVWDGWKEFLMGCLLGQKLKVQRYLSKEGPVLKYQKRVALYIAAFCGYIELTEWALKQGARPHEAVGVHPYRAWCHEALHADVSKCPIHAAAEAGQLLILKAFVNYSVLCLECKNAAGQTPLTIVFKHKHKDCVLYLLSKMWSTVSFPKISVPMRIYIKIKQWILRAQSHSLHKSQFCGARVFGAKVGDTVMVDGFTKPKMTSKSWHKAGNSDSQSIVLKLPSLSKQTASSKPVNPLAISQPDTRKQALKFHPLVNASSFSELQKHQQQNQKKITATARKKEKLIKNTYLPQVPLPPVSRVGYSHPSFFYATPSADFLLKSSFSSFLEHSGKTPWENAIYCLAVAR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
46	Phosphorylation	EDKQGRRYLELMYAG CCCCCHHHHHHHHHH	11.81	1994603
68	Phosphorylation	SLADVGISFCSTLKC HHHHHHHHHHHCCEE	17.80	102778019
71	Phosphorylation	DVGISFCSTLKCFVK HHHHHHHHCCEEEEC	34.46	102778025
72	Phosphorylation	VGISFCSTLKCFVKE HHHHHHHCCEEEECC	31.27	25850435
95	Phosphorylation	FNAVTQDTMPVMESI EEECCCCCHHHHHHH	17.35	46106431
148	Phosphorylation	NTLKDYQTDIGTTLR CCCHHCCCCCCCCEE	24.29	50565659
384	Phosphorylation	LPSLSKQTASSKPVN CCCCCCCCCCCCCCC	32.04	46106437
396	Phosphorylation	PVNPLAISQPDTRKQ CCCCCCCCCCCHHHH	30.01	113136255
400	Phosphorylation	LAISQPDTRKQALKF CCCCCCCHHHHHHHH	46.58	113136259
478 (in isoform 2)	Phosphorylation	-		-
478	Phosphorylation	ADFLLKSSFSSFLEH HHHHHHHHHHHHHHH		-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ANKUB_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ANKUB_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ANKUB_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ANKUB_HUMAN !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ANKUB_HUMAN

Related Literatures of Post-Translational Modification