ANKR9_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ANKR9_HUMAN
• UniProt AC: Q96BM1
• Protein Name: Ankyrin repeat domain-containing protein 9
• Gene Name: ANKRD9
• Organism: Homo sapiens (Human).
• Sequence Length: 317
• Protein Sequence: MPWDARRPGGGADGGPEASGAARSRAQKQCRKSSFAFYQAVRDLLPVWLLEDMRASEAFHWDERGRAAAYSPSEALLYALVHDHQAYAHYLLATFPRRALAPPSAGFRCCAAPGPHVALAVRYNRVGILRRILRTLRDFPAEERARVLDRRGCSRVEGGGTSLHVACELARPECLFLLLGHGASPGLRDGGGLTPLELLLRQLGRDAGATPSAAGAPASAPGEPRQRRLLLLDLLALYTPVGAAGSARQELLGDRPRWQRLLGEDKFQWLAGLAPPSLFARAMQVLVTAISPGRFPEALDELPLPPFLQPLDLTGKG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
33	Phosphorylation	AQKQCRKSSFAFYQA HHHHHHHHHHHHHHH	16.01	50565619
34	Phosphorylation	QKQCRKSSFAFYQAV HHHHHHHHHHHHHHH	24.51	50565625
38	Phosphorylation	RKSSFAFYQAVRDLL HHHHHHHHHHHHHHH	7.67	50565631

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ANKR9_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ANKR9_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ANKR9_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of ANKR9_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.