UniProt ID | ANGP4_HUMAN | |
---|---|---|
UniProt AC | Q9Y264 | |
Protein Name | Angiopoietin-4 | |
Gene Name | ANGPT4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 503 | |
Subcellular Localization | Secreted . | |
Protein Description | Binds to TEK/TIE2, modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2. Promotes endothelial cell survival, migration and angiogenesis.. | |
Protein Sequence | MLSQLAMLQGSLLLVVATMSVAQQTRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTILRSKLEQVQQQMAQNQTAPMLELGTSLLNQTTAQIRKLTDMEAQLLNQTSRMDAQMPETFLSTNKLENQLLLQRQKLQQLQGQNSALEKRLQALETKQQEELASILSKKAKLLNTLSRQSAALTNIERGLRGVRHNSSLLQDQQHSLRQLLVLLRHLVQERANASAPAFIMAGEQVFQDCAEIQRSGASASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEHWLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQSSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFDACGLSNLNGVYYHAPDNKYKMDGIRWHYFKGPSYSLRASRMMIRPLDI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MLSQLAMLQG -----CHHHHHHHHH | 23.11 | 24043423 | |
11 | Phosphorylation | QLAMLQGSLLLVVAT HHHHHHHHHHHHHHH | 11.68 | 24043423 | |
18 | Phosphorylation | SLLLVVATMSVAQQT HHHHHHHHHHHHHHH | 9.81 | 24043423 | |
20 | Phosphorylation | LLVVATMSVAQQTRQ HHHHHHHHHHHHHHH | 15.22 | 24043423 | |
25 | Phosphorylation | TMSVAQQTRQEADRG HHHHHHHHHHHHHCC | 23.41 | 24043423 | |
72 | Phosphorylation | SNTLQRESLANPLHL CCCCCHHHCCCCHHH | 34.66 | 46163225 | |
96 | N-linked_Glycosylation | QLEQALQNNTQWLKK HHHHHHHHCHHHHHH | 55.13 | UniProtKB CARBOHYD | |
126 | N-linked_Glycosylation | VQQQMAQNQTAPMLE HHHHHHHCCCHHHHH | 31.47 | UniProtKB CARBOHYD | |
140 | N-linked_Glycosylation | ELGTSLLNQTTAQIR HHHHHHHHHHHHHHH | 42.31 | UniProtKB CARBOHYD | |
150 | Phosphorylation | TAQIRKLTDMEAQLL HHHHHHHHHHHHHHH | 36.01 | 46163231 | |
158 | N-linked_Glycosylation | DMEAQLLNQTSRMDA HHHHHHHHHHCCHHC | 52.23 | UniProtKB CARBOHYD | |
215 | Phosphorylation | KQQEELASILSKKAK HHHHHHHHHHHHHHH | 36.37 | 24719451 | |
226 | Phosphorylation | KKAKLLNTLSRQSAA HHHHHHHHHHHHHHH | 26.53 | 46163237 | |
228 | Phosphorylation | AKLLNTLSRQSAALT HHHHHHHHHHHHHHH | 26.66 | 46163221 | |
247 | N-linked_Glycosylation | GLRGVRHNSSLLQDQ HHHHHHCCHHHHHHH | 23.80 | UniProtKB CARBOHYD | |
248 | Phosphorylation | LRGVRHNSSLLQDQQ HHHHHCCHHHHHHHH | 19.08 | 22817900 | |
249 | Phosphorylation | RGVRHNSSLLQDQQH HHHHCCHHHHHHHHH | 38.11 | 22817900 | |
274 | N-linked_Glycosylation | HLVQERANASAPAFI HHHHHHHHCCCCCCH | 40.42 | UniProtKB CARBOHYD | |
311 | N-linked_Glycosylation | VYTIQVSNATKPRKV EEEEEEECCCCCCEE | 53.42 | UniProtKB CARBOHYD | |
324 | Phosphorylation | KVFCDLQSSGGRWTL EEEEEECCCCCCEEE | 37.94 | 25954137 | |
337 | N-linked_Glycosylation | TLIQRRENGTVNFQR EEEEEECCCCCCEEE | 50.01 | UniProtKB CARBOHYD | |
377 | Phosphorylation | LTRRAAYSLRVELQD HHHHHHHHEEEEEEC | 12.65 | 24719451 | |
427 | N-linked_Glycosylation | QSSLVLQNTSFSTLD CCCEEEECCCCCCCC | 33.26 | UniProtKB CARBOHYD | |
490 | Phosphorylation | YFKGPSYSLRASRMM EECCCCCCHHHHHEE | 18.73 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ANGP4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ANGP4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ANGP4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ANGP4_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...