| UniProt ID | ANCHR_MOUSE | |
|---|---|---|
| UniProt AC | Q9DAZ9 | |
| Protein Name | Abscission/NoCut checkpoint regulator | |
| Gene Name | Zfyve19 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 389 | |
| Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Cleavage furrow . Midbody, Midbody ring . Localizes mainly on centrosomes in interphase and early mitosis. Localizes at the cleavage furrow and midbody ring in late mitosis and cyto | |
| Protein Description | Key regulator of abscission step in cytokinesis: part of the cytokinesis checkpoint, a process required to delay abscission to prevent both premature resolution of intercellular chromosome bridges and accumulation of DNA damage. Together with CHMP4C, required to retain abscission-competent VPS4 (VPS4A and/or VPS4B) at the midbody ring until abscission checkpoint signaling is terminated at late cytokinesis. Deactivation of AURKB results in dephosphorylation of CHMP4C followed by its dissociation from ZFYVE19/ANCHR and VPS4 and subsequent abscission (By similarity).. | |
| Protein Sequence | MESRCYGCAVKFTLFKKEYGCKNCGRAFCNGCLSFSALVPRAGNTQQKVCKQCHTILTRGSSDNASKWSPPQNYKKRVAALEAKKKSSTSHSQSLTHKDQAIAERLARLRQENKPKSVPSQAEIEARLAALKDEVQGPIPSTQEMEDRLAALQGRVPPSHTVRPAHQAPDTRTQAQQTQDLLTQLTAEVAIDENCQPRASASLQNDLNKGAARSQRTNSQGQASQSLEEEKYKLLAEAAVELQEENTRQERILALAKRLAVLKGQDPSRVTLQDYHLPDSDEDEETAIQRVMQQLTEEAALDEASGFNIPEKPAPGSRAQPCKAEMEGPQAEEEELPWCCICNEDATLRCAGCDGDLYCARCFREGHDNFDLKEHQTSPYHPRRPCQEH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 61 | Phosphorylation | HTILTRGSSDNASKW CHHHHCCCCCCHHHC | 26643407 | ||
| 62 | Phosphorylation | TILTRGSSDNASKWS HHHHCCCCCCHHHCC | 26643407 | ||
| 66 | Phosphorylation | RGSSDNASKWSPPQN CCCCCCHHHCCCCCC | 25266776 | ||
| 69 | Phosphorylation | SDNASKWSPPQNYKK CCCHHHCCCCCCHHH | 27742792 | ||
| 74 | Phosphorylation | KWSPPQNYKKRVAAL HCCCCCCHHHHHHHH | 26643407 | ||
| 87 | Phosphorylation | ALEAKKKSSTSHSQS HHHHHHHCCCCCHHH | 29472430 | ||
| 88 | Phosphorylation | LEAKKKSSTSHSQSL HHHHHHCCCCCHHHC | 29472430 | ||
| 89 | Phosphorylation | EAKKKSSTSHSQSLT HHHHHCCCCCHHHCC | 29472430 | ||
| 92 | Phosphorylation | KKSSTSHSQSLTHKD HHCCCCCHHHCCHHH | 29472430 | ||
| 94 | Phosphorylation | SSTSHSQSLTHKDQA CCCCCHHHCCHHHHH | 25266776 | ||
| 96 | Phosphorylation | TSHSQSLTHKDQAIA CCCHHHCCHHHHHHH | 29472430 | ||
| 173 | Phosphorylation | HQAPDTRTQAQQTQD CCCCCCHHHHHHHHH | 25367039 | ||
| 178 | Phosphorylation | TRTQAQQTQDLLTQL CHHHHHHHHHHHHHH | 25367039 | ||
| 183 | Phosphorylation | QQTQDLLTQLTAEVA HHHHHHHHHHHHHHH | 25367039 | ||
| 186 | Phosphorylation | QDLLTQLTAEVAIDE HHHHHHHHHHHHCCC | 25367039 | ||
| 202 | Phosphorylation | CQPRASASLQNDLNK CCCCCCHHHHCHHHH | 27841257 | ||
| 214 | Phosphorylation | LNKGAARSQRTNSQG HHHHHHHHHHHCCCC | 22802335 | ||
| 217 | Phosphorylation | GAARSQRTNSQGQAS HHHHHHHHCCCCCCC | 27087446 | ||
| 219 | Phosphorylation | ARSQRTNSQGQASQS HHHHHHCCCCCCCCC | 25521595 | ||
| 224 | Phosphorylation | TNSQGQASQSLEEEK HCCCCCCCCCHHHHH | 26643407 | ||
| 226 | Phosphorylation | SQGQASQSLEEEKYK CCCCCCCCHHHHHHH | 26643407 | ||
| 231 | Ubiquitination | SQSLEEEKYKLLAEA CCCHHHHHHHHHHHH | 22790023 | ||
| 232 | Phosphorylation | QSLEEEKYKLLAEAA CCHHHHHHHHHHHHH | 24759943 | ||
| 271 | Phosphorylation | GQDPSRVTLQDYHLP CCCCCCCEEEEECCC | 25619855 | ||
| 275 | Phosphorylation | SRVTLQDYHLPDSDE CCCEEEEECCCCCCC | 25619855 | ||
| 280 | Phosphorylation | QDYHLPDSDEDEETA EEECCCCCCCCHHHH | 24925903 | ||
| 286 | Phosphorylation | DSDEDEETAIQRVMQ CCCCCHHHHHHHHHH | 25619855 | ||
| 377 | Phosphorylation | FDLKEHQTSPYHPRR CCCCCCCCCCCCCCC | 28066266 | ||
| 378 | Phosphorylation | DLKEHQTSPYHPRRP CCCCCCCCCCCCCCC | 25521595 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ANCHR_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ANCHR_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ANCHR_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ANCHR_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...