| UniProt ID | AN33B_HUMAN | |
|---|---|---|
| UniProt AC | A6NCL7 | |
| Protein Name | Ankyrin repeat domain-containing protein 33B | |
| Gene Name | ANKRD33B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 494 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MVLLAGTGPEGGGARCMTPPPPSPPRGAQVEEDPADYEEFEDFSSLPDTRSIASDDSFYPFEDEEEHGVESAESVPEGVPESVPETATLLRAACANNVGLLRTLVRRGVSVEEAQETDRNGRTGLIVACYHGFVDTVVALAECPHVDVNWQDSEGNTALITAAQAGHAIITNYLLNYFPGLDLERRNAFGFTALMKAAMQGRTDCIRALMLAGADVHARDPRRGMSPQEWATYTGRVDAVRLMQRLLERPCPEQFWEKYRPELPPPPEAARKPAGSKNCLQRLTDCVLSVLTPRSVRGPEDGGVLDHMVRMTTSLYSPAVAIVCQTVCPESPPSVGKRRLAVQEILAARAARGPQAQEEDEVGGAGQRGRTGQEDADSREGSPRAGLPPALGSRGPAAPAPRKASLLPLQRLRRRSVRPGVVVPRVRVSKAPAPTFQPERPARKGSTKDSGHLQIPKWRYKEAKEEKRKAEEAEKKRQAEAQKERRTAPWKKRT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 23 | Phosphorylation | CMTPPPPSPPRGAQV CCCCCCCCCCCCCCC | 54.00 | 17081983 | |
| 37 | Phosphorylation | VEEDPADYEEFEDFS CCCCCCCHHHHCCHH | 21.33 | 27642862 | |
| 44 | Phosphorylation | YEEFEDFSSLPDTRS HHHHCCHHCCCCCCC | 43.20 | 26471730 | |
| 45 | Phosphorylation | EEFEDFSSLPDTRSI HHHCCHHCCCCCCCC | 43.87 | 27642862 | |
| 49 | Phosphorylation | DFSSLPDTRSIASDD CHHCCCCCCCCCCCC | 25.11 | 26471730 | |
| 110 | Phosphorylation | TLVRRGVSVEEAQET HHHHCCCCHHHHHHH | 27.00 | 28674419 | |
| 203 | Phosphorylation | KAAMQGRTDCIRALM HHHHCCCHHHHHHHH | 41.89 | 29083192 | |
| 284 | Phosphorylation | KNCLQRLTDCVLSVL CHHHHHHHHHHHHHH | 29.55 | 23312004 | |
| 289 | Phosphorylation | RLTDCVLSVLTPRSV HHHHHHHHHHCCCCC | 8.49 | 23312004 | |
| 370 | Methylation | GGAGQRGRTGQEDAD CCCCCCCCCCCCCCC | 37.56 | - | |
| 405 | Phosphorylation | APAPRKASLLPLQRL CCCCCCCCCHHHHHH | 33.21 | 27422710 | |
| 416 | Phosphorylation | LQRLRRRSVRPGVVV HHHHHHCCCCCCEEE | 22.22 | 27422710 | |
| 464 | Acetylation | KWRYKEAKEEKRKAE CCHHHHHHHHHHHHH | 68.45 | 7395505 | |
| 467 | Acetylation | YKEAKEEKRKAEEAE HHHHHHHHHHHHHHH | 61.36 | 7395515 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AN33B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AN33B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AN33B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of AN33B_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...