UniProt ID | AN33B_HUMAN | |
---|---|---|
UniProt AC | A6NCL7 | |
Protein Name | Ankyrin repeat domain-containing protein 33B | |
Gene Name | ANKRD33B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 494 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MVLLAGTGPEGGGARCMTPPPPSPPRGAQVEEDPADYEEFEDFSSLPDTRSIASDDSFYPFEDEEEHGVESAESVPEGVPESVPETATLLRAACANNVGLLRTLVRRGVSVEEAQETDRNGRTGLIVACYHGFVDTVVALAECPHVDVNWQDSEGNTALITAAQAGHAIITNYLLNYFPGLDLERRNAFGFTALMKAAMQGRTDCIRALMLAGADVHARDPRRGMSPQEWATYTGRVDAVRLMQRLLERPCPEQFWEKYRPELPPPPEAARKPAGSKNCLQRLTDCVLSVLTPRSVRGPEDGGVLDHMVRMTTSLYSPAVAIVCQTVCPESPPSVGKRRLAVQEILAARAARGPQAQEEDEVGGAGQRGRTGQEDADSREGSPRAGLPPALGSRGPAAPAPRKASLLPLQRLRRRSVRPGVVVPRVRVSKAPAPTFQPERPARKGSTKDSGHLQIPKWRYKEAKEEKRKAEEAEKKRQAEAQKERRTAPWKKRT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
23 | Phosphorylation | CMTPPPPSPPRGAQV CCCCCCCCCCCCCCC | 54.00 | 17081983 | |
37 | Phosphorylation | VEEDPADYEEFEDFS CCCCCCCHHHHCCHH | 21.33 | 27642862 | |
44 | Phosphorylation | YEEFEDFSSLPDTRS HHHHCCHHCCCCCCC | 43.20 | 26471730 | |
45 | Phosphorylation | EEFEDFSSLPDTRSI HHHCCHHCCCCCCCC | 43.87 | 27642862 | |
49 | Phosphorylation | DFSSLPDTRSIASDD CHHCCCCCCCCCCCC | 25.11 | 26471730 | |
110 | Phosphorylation | TLVRRGVSVEEAQET HHHHCCCCHHHHHHH | 27.00 | 28674419 | |
203 | Phosphorylation | KAAMQGRTDCIRALM HHHHCCCHHHHHHHH | 41.89 | 29083192 | |
284 | Phosphorylation | KNCLQRLTDCVLSVL CHHHHHHHHHHHHHH | 29.55 | 23312004 | |
289 | Phosphorylation | RLTDCVLSVLTPRSV HHHHHHHHHHCCCCC | 8.49 | 23312004 | |
370 | Methylation | GGAGQRGRTGQEDAD CCCCCCCCCCCCCCC | 37.56 | - | |
405 | Phosphorylation | APAPRKASLLPLQRL CCCCCCCCCHHHHHH | 33.21 | 27422710 | |
416 | Phosphorylation | LQRLRRRSVRPGVVV HHHHHHCCCCCCEEE | 22.22 | 27422710 | |
464 | Acetylation | KWRYKEAKEEKRKAE CCHHHHHHHHHHHHH | 68.45 | 7395505 | |
467 | Acetylation | YKEAKEEKRKAEEAE HHHHHHHHHHHHHHH | 61.36 | 7395515 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AN33B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AN33B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AN33B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of AN33B_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...