UniProt ID | AMY1_MOUSE | |
---|---|---|
UniProt AC | P00687 | |
Protein Name | Alpha-amylase 1 | |
Gene Name | Amy1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 511 | |
Subcellular Localization | Secreted. | |
Protein Description | ||
Protein Sequence | MKFFLLLSLIGFCWAQYDPHTQYGRTAIVHLFEWRWVDIAKECERYLAPNGFAGVQVSPPNENIVVHSPSRPWWERYQPISYKICSRSGNEDEFRDMVNRCNNVGVRIYVDAVINHMCGVGAQAGQSSTCGSYFNPNNRDFPGVPYSGFDFNDGKCRTASGGIENYQDAAQVRDCRLSGLLDLALEKDYVRTKVADYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNTKWFSQGSRPFIFQEVIDLGGEAVSSNEYFGNGRVTEFKYGAKLGKVMRKWDGEKMSYLKNWGEGWGLMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYYWPRNFQNGKDVNDWVGPPNNNGKTKEVSINPDSTCGNDWICEHRWRQIRNMVAFRNVVNGQPFANWWDNDSNQVAFGRGNKGFIVFNNDDWALSETLQTGLPAGTYCDVISGDKVDGNCTGIKVYVGNDGKAHFSISNSAEDPFIAIHAESKI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Pyrrolidone_carboxylic_acid | LIGFCWAQYDPHTQY HHHHHHHHCCCCCCC | 20.75 | - | |
16 | Pyrrolidone_carboxylic_acid | LIGFCWAQYDPHTQY HHHHHHHHCCCCCCC | 20.75 | - | |
26 | Phosphorylation | PHTQYGRTAIVHLFE CCCCCCCEEEEEEEE | 19.17 | 21082442 | |
81 | Phosphorylation | WERYQPISYKICSRS HHHCCCCCEEECCCC | 27.36 | 23737553 | |
178 | Phosphorylation | QVRDCRLSGLLDLAL HHHHCHHHHHHHHHH | 14.19 | 81018341 | |
193 | Ubiquitination | EKDYVRTKVADYMNH HCCHHHHHHHHHHHH | 25.51 | - | |
215 | Ubiquitination | GFRLDASKHMWPGDI EEEEECHHCCCCHHH | 38.92 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AMY1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AMY1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AMY1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AKAP8_MOUSE | Akap8 | physical | 12414807 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...