dbPTM

AMT13_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	AMT13_ARATH
UniProt AC	Q9SQH9
Protein Name	Ammonium transporter 1 member 3
Gene Name	AMT1-3
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	498
Subcellular Localization	Cell membrane Multi-pass membrane protein .
Protein Description	Ammonium transporter probably involved in ammonium uptake from the soil. Contributes with AMT1-1 to the overall ammonium uptake capacity in roots under nitrogen-deficiency conditions..
Protein Sequence	MSGAITCSAADLATLLGPNATAAADYICGQLGTVNNKFTDAAFAIDNTYLLFSAYLVFAMQLGFAMLCAGSVRAKNTMNIMLTNVLDAAAGGLFYYLFGYAFAFGGSSEGFIGRHNFALRDFPTPTADYSFFLYQWAFAIAAAGITSGSIAERTQFVAYLIYSSFLTGFVYPVVSHWFWSPDGWASPFRSADDRLFSTGAIDFAGSGVVHMVGGIAGLWGALIEGPRRGRFEKGGRAIALRGHSASLVVLGTFLLWFGWYGFNPGSFTKILVPYNSGSNYGQWSGIGRTAVNTTLSGCTAALTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVEPWAAIVCGFMASVVLIGCNKLAELVQYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYLNEVYGATPGRPYGLFMGGGGKLLGAQLVQILVIVGWVSATMGTLFFILKRLNLLRISEQHEMQGMDMTRHGGFAYIYHDNDDESHRVDPGSPFPRSATPPRV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
464	Phosphorylation	EMQGMDMTRHGGFAY HHCCCCCCCCCCEEE	18.43	23111157
480	Phosphorylation	YHDNDDESHRVDPGS EECCCCCCCCCCCCC	24.48	27532006
487	Phosphorylation	SHRVDPGSPFPRSAT CCCCCCCCCCCCCCC	28.84	23776212
492	Phosphorylation	PGSPFPRSATPPRV- CCCCCCCCCCCCCC-	36.41	28011693
494	Phosphorylation	SPFPRSATPPRV--- CCCCCCCCCCCC---	34.76	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of AMT13_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of AMT13_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of AMT13_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of AMT13_ARATH

Related Literatures of Post-Translational Modification