AMT12_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AMT12_ARATH
• UniProt AC: Q9ZPJ8
• Protein Name: Ammonium transporter 1 member 2
• Gene Name: AMT1-2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 514
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Description: Ammonium transporter probably involved in ammonium uptake from the soil..
• Protein Sequence: MDTATTTCSAVDLSALLSSSSNSTSSLAAATFLCSQISNISNKLSDTTYAVDNTYLLFSAYLVFAMQLGFAMLCAGSVRAKNTMNIMLTNVLDAAAGAISYYLFGFAFAFGTPSNGFIGRHHSFFALSSYPERPGSDFSFFLYQWAFAIAAAGITSGSIAERTQFVAYLIYSTFLTGFVYPTVSHWFWSSDGWASASRSDNNLLFGSGAIDFAGSGVVHMVGGIAGLCGALVEGPRIGRFDRSGRSVALRGHSASLVVLGTFLLWFGWYGFNPGSFLTILKGYDKSRPYYGQWSAVGRTAVTTTLSGCTAALTTLFSKRLLAGHWNVIDVCNGLLGGFAAITSGCAVVEPWAAIVCGFVASWVLIGFNLLAKKLKYDDPLEAAQLHGGCGAWGLIFTGLFARKEYVNEIYSGDRPYGLFMGGGGKLLAAQIVQIIVIVGWVTVTMGPLFYGLHKMNLLRISAEDEMAGMDMTRHGGFAYAYNDEDDVSTKPWGHFAGRVEPTSRSSTPTPTLTV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
472	Phosphorylation	EMAGMDMTRHGGFAY HHCCCCCCCCCCEEE	18.43	30291188
488	Phosphorylation	YNDEDDVSTKPWGHF ECCCCCCCCCCCCCC	37.39	26811356
502	Phosphorylation	FAGRVEPTSRSSTPT CCCCCCCCCCCCCCC	24.22	30407730
503	Phosphorylation	AGRVEPTSRSSTPTP CCCCCCCCCCCCCCC	40.66	30407730
505	Phosphorylation	RVEPTSRSSTPTPTL CCCCCCCCCCCCCCC	38.03	30407730
506	Phosphorylation	VEPTSRSSTPTPTLT CCCCCCCCCCCCCCC	36.98	30407730
507	Phosphorylation	EPTSRSSTPTPTLTV CCCCCCCCCCCCCCC	32.21	30407730
509	Phosphorylation	TSRSSTPTPTLTV-- CCCCCCCCCCCCC--	29.06	30407730
511	Phosphorylation	RSSTPTPTLTV---- CCCCCCCCCCC----	37.22	30407730
513	Phosphorylation	STPTPTLTV------ CCCCCCCCC------	27.01	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AMT12_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AMT12_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AMT12_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PAM74_ARATH	AT5G59650	physical	21423366

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Phosphoproteomic analysis of nuclei-enriched fractions fromArabidopsis thaliana.";
Jones A.M.E., MacLean D., Studholme D.J., Serna-Sanz A.,Andreasson E., Rathjen J.P., Peck S.C.;
J. Proteomics 72:439-451(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-472, AND MASSSPECTROMETRY.
PubMed: 19245862