UniProt ID | ALKB1_HUMAN | |
---|---|---|
UniProt AC | Q13686 | |
Protein Name | Nucleic acid dioxygenase ALKBH1 {ECO:0000305} | |
Gene Name | ALKBH1 {ECO:0000312|HGNC:HGNC:17911} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 389 | |
Subcellular Localization | Nucleus . Mitochondrion . Mainly localizes in euchromatin, largely excluded from heterochromatin and nucleoli (By similarity). | |
Protein Description | Dioxygenase that acts as on nucleic acids, such as DNA and tRNA. [PubMed: 18603530] | |
Protein Sequence | MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPDS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
61 | Ubiquitination | GKGPGAQKVIKSQLN CCCCCHHHHHHHHHC | 45.45 | - | |
64 | Ubiquitination | PGAQKVIKSQLNVSS CCHHHHHHHHHCCCC | 34.83 | - | |
87 | Ubiquitination | AGLQPVSKWQAYGLK CCCCCCHHHHHCCCC | 43.49 | - | |
123 | Phosphorylation | KQCLKLYSQKPNVCN HHHHHHHHCCCCCCC | 42.01 | 68703615 | |
125 | Ubiquitination | CLKLYSQKPNVCNLD HHHHHHCCCCCCCHH | 32.40 | - | |
133 | Ubiquitination | PNVCNLDKHMSKEET CCCCCHHHCCCHHHH | 44.36 | - | |
136 | Phosphorylation | CNLDKHMSKEETQDL CCHHHCCCHHHHHHH | 36.31 | 68703621 | |
137 | Ubiquitination | NLDKHMSKEETQDLW CHHHCCCHHHHHHHH | 52.58 | 21906983 | |
147 | Phosphorylation | TQDLWEQSKEFLRYK HHHHHHHHHHHHHHH | 23.72 | 68703627 | |
148 | Ubiquitination | QDLWEQSKEFLRYKE HHHHHHHHHHHHHHH | 52.78 | - | |
163 | Phosphorylation | ATKRRPRSLLEKLRW HHHCCCHHHHHHCCE | 39.73 | 24719451 | |
189 | Phosphorylation | KKYSADHYTPFPSDL CCEECCCCCCCCHHH | 19.36 | 30576142 | |
200 | Phosphorylation | PSDLGFLSEQVAAAC CHHHHHHHHHHHHHC | 24.58 | 30576142 | |
240 | Phosphorylation | DRSELDHSKPLLSFS CHHHCCCCCCEEEEE | 35.32 | 24719451 | |
362 | Ubiquitination | LEPIEDEKRDISTEG CCCCCCCCCCCCCCC | 68.63 | 2190698 | |
381 | Ubiquitination | DDQNSEVKRARINPD CCCCCCCCCCCCCCC | 35.97 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ALKB1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ALKB1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ALKB1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DNJB6_HUMAN | DNAJB6 | physical | 18163532 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...