ALG5_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ALG5_HUMAN
• UniProt AC: Q9Y673
• Protein Name: Dolichyl-phosphate beta-glucosyltransferase
• Gene Name: ALG5
• Organism: Homo sapiens (Human).
• Sequence Length: 324
• Subcellular Localization: Endoplasmic reticulum membrane; Single-pass type II membrane protein.
• Protein Sequence: MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
50	Ubiquitination	EKFFLNAKGQKETLP HCEEECCCCCCCCCC	61.88	32015554
55	Ubiquitination	NAKGQKETLPSIWDS CCCCCCCCCCCCCCC	51.51	22817900
58	Phosphorylation	GQKETLPSIWDSPTK CCCCCCCCCCCCCCC	39.15	30266825
59	Ubiquitination	QKETLPSIWDSPTKQ CCCCCCCCCCCCCCE	4.47	22817900
62	Phosphorylation	TLPSIWDSPTKQLSV CCCCCCCCCCCEEEE	21.33	30266825
64	Phosphorylation	PSIWDSPTKQLSVVV CCCCCCCCCEEEEEC	35.06	30266825
65	Ubiquitination	SIWDSPTKQLSVVVP CCCCCCCCEEEEECC	53.26	21906983
76	Ubiquitination	VVVPSYNEEKRLPVM EECCCCCCHHCCCCC	57.57	27667366
78	Ubiquitination	VPSYNEEKRLPVMMD CCCCCCHHCCCCCHH	53.72	29967540
102	Phosphorylation	QKRDPAFTYEVIVVD HHCCCCCEEEEEEEC	22.37	46162287
109	Ubiquitination	TYEVIVVDDGSKDQT EEEEEEECCCCCCCH	43.59	27667366
113	Ubiquitination	IVVDDGSKDQTSKVA EEECCCCCCCHHHHH	60.42	22817900
118	Ubiquitination	GSKDQTSKVAFKYCQ CCCCCHHHHHHHHHH	40.75	21906983
122	Ubiquitination	QTSKVAFKYCQKYGS CHHHHHHHHHHHHCC	35.07	22817900
122	Acetylation	QTSKVAFKYCQKYGS CHHHHHHHHHHHHCC	35.07	25953088
123	Phosphorylation	TSKVAFKYCQKYGSD HHHHHHHHHHHHCCC	8.15	46162293
126	Acetylation	VAFKYCQKYGSDKVR HHHHHHHHHCCCCEE	48.28	25953088
127	Phosphorylation	AFKYCQKYGSDKVRV HHHHHHHHCCCCEEE	8.93	30453579
129	Phosphorylation	KYCQKYGSDKVRVIT HHHHHHCCCCEEEEE	31.03	46162281
139	Acetylation	VRVITLVKNRGKGGA EEEEEEEEECCCCCC	44.00	25953088
139	Ubiquitination	VRVITLVKNRGKGGA EEEEEEEEECCCCCC	44.00	22817900
139	Malonylation	VRVITLVKNRGKGGA EEEEEEEEECCCCCC	44.00	26320211
145	Ubiquitination	VKNRGKGGAIRMGIF EEECCCCCCEEEEEE	22.70	29967540
172	Ubiquitination	DGATKFPDVEKLEKG CCCCCCCCHHHHHHC	65.42	22817900
175	Ubiquitination	TKFPDVEKLEKGLND CCCCCHHHHHHCCHH	62.89	29967540
176	Ubiquitination	KFPDVEKLEKGLNDL CCCCHHHHHHCCHHC	5.35	24816145
202	2-Hydroxyisobutyrylation	GSRAHLEKESIAQRS CCCHHHCHHHHHHHH	64.22	-
202	Ubiquitination	GSRAHLEKESIAQRS CCCHHHCHHHHHHHH	64.22	21906983
209	Ubiquitination	KESIAQRSYFRTLLM HHHHHHHHHHHHHHH	19.28	24816145
234	Phosphorylation	CVKGIRDTQCGFKLF HHHCCCCCCCCCEEE	18.86	68720329
239	Ubiquitination	RDTQCGFKLFTREAA CCCCCCCEEEHHHHH	28.16	24816145
281	N-linked_Glycosylation	PIAEIAVNWTEIEGS CHHEEECCCEEECCC	30.81	UniProtKB CARBOHYD

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ALG5_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ALG5_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ALG5_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PKD2_HUMAN	PKD2	physical	26186194
PKD2_HUMAN	PKD2	physical	28514442
AAAT_HUMAN	SLC1A5	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.