UniProt ID | ALG2_MOUSE | |
---|---|---|
UniProt AC | Q9DBE8 | |
Protein Name | Alpha-1,3/1,6-mannosyltransferase ALG2 | |
Gene Name | Alg2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 415 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | Mannosylates Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate.. | |
Protein Sequence | MAENLYRARSRVYSPSVLFLHPDMGIGGAERLVLDAALALQEYGCDVKIWTAHYDPNHCFIETRELSVQCAGDWLPRSLGWGGRGAAICSYVRMVFLALYVLFLSGEEFDVVVCDQVSACIPVFKLARRRKRVLFYCHFPDLLLTQRNSALKKFYRAPIDWIEEYTTGMADRILVNSQYTASVFKETFKTLSHRNPDVLYPSLNIGSFDLAIPEKIDDLVPKGKQFLFLSINRYERKKNLPLALRSLVQLRNRLPSQEWDKVHLFMAGGYDDRIPENVEHYKELKKMVQESDLERHVTFLRSFSDRQKISLLHGCLCVLYTPSNEHFGIVPLEAMYMQCPVIAVNNGGPLESIVHKVTGFLCEPDPVHFSEAMEKFIHKPSLKATMGLAGKARVAEKFSADAFADQLYQYVTKLV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | ENLYRARSRVYSPSV CHHHHHHHHCCCCCE | 25.72 | 18846507 | |
13 | Phosphorylation | YRARSRVYSPSVLFL HHHHHHCCCCCEEEE | 17.47 | 18846507 | |
14 | Phosphorylation | RARSRVYSPSVLFLH HHHHHCCCCCEEEEC | 14.08 | 18846507 | |
16 | Phosphorylation | RSRVYSPSVLFLHPD HHHCCCCCEEEECCC | 26.05 | 18846507 | |
165 | Ubiquitination | PIDWIEEYTTGMADR CCHHHHHHCCCCCCE | 9.23 | 27667366 | |
185 | Ubiquitination | QYTASVFKETFKTLS HHHHHHHHHHHHHHH | 54.40 | 22790023 | |
238 | Ubiquitination | INRYERKKNLPLALR EEHHHHHCCCCHHHH | 70.68 | 27667366 | |
256 | Phosphorylation | QLRNRLPSQEWDKVH HHHHCCCCCCCCCEE | 45.37 | 18319177 | |
291 | O-linked_Glycosylation | LKKMVQESDLERHVT HHHHHHHHHHHHHHH | 30.33 | 30059200 | |
318 | Ubiquitination | LLHGCLCVLYTPSNE HHCCCEEEEECCCCC | 2.71 | 27667366 | |
381 | Phosphorylation | EKFIHKPSLKATMGL HHHCCCCCHHHHHCC | 47.51 | 52836487 | |
391 | Ubiquitination | ATMGLAGKARVAEKF HHHCCCCHHHHHHHH | 27.67 | 27667366 | |
397 | Ubiquitination | GKARVAEKFSADAFA CHHHHHHHHCHHHHH | 34.58 | 22790023 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ALG2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ALG2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ALG2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ALG2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...