UniProt ID | ALDR_MOUSE | |
---|---|---|
UniProt AC | P45376 | |
Protein Name | Aldose reductase | |
Gene Name | Akr1b1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 316 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols with a broad range of catalytic efficiencies.. | |
Protein Sequence | MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDLGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDKSMVKGAFQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKTIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPVRIAENLKVFDFEVSSEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MASHLELNN ------CCCCEECCC | 12.98 | - | |
3 | Phosphorylation | -----MASHLELNNG -----CCCCEECCCC | 27.57 | 30352176 | |
12 | Ubiquitination | LELNNGTKMPTLGLG EECCCCCCCCCCCCC | 44.26 | - | |
15 | Phosphorylation | NNGTKMPTLGLGTWK CCCCCCCCCCCCCCC | 29.93 | 24759943 | |
23 | Phosphorylation | LGLGTWKSPPGQVTE CCCCCCCCCCCCHHH | 28.08 | 28066266 | |
29 | Phosphorylation | KSPPGQVTEAVKVAI CCCCCCHHHHHHHHH | 15.44 | 28464351 | |
45 | S-nitrosocysteine | LGYRHIDCAQVYQNE CCCCEEEHHHHHCCH | 2.56 | - | |
45 | S-nitrosylation | LGYRHIDCAQVYQNE CCCCEEEHHHHHCCH | 2.56 | 21278135 | |
49 | Phosphorylation | HIDCAQVYQNEKEVG EEEHHHHHCCHHHHH | 8.11 | 22817900 | |
53 | Acetylation | AQVYQNEKEVGVALQ HHHHCCHHHHHHHHH | 66.31 | 22826441 | |
78 | Acetylation | QDLFIVSKLWCTFHD HCCEEEEEEECCCCC | 34.80 | 22826441 | |
81 | S-nitrosocysteine | FIVSKLWCTFHDKSM EEEEEEECCCCCHHH | 4.17 | - | |
81 | S-nitrosylation | FIVSKLWCTFHDKSM EEEEEEECCCCCHHH | 4.17 | 21278135 | |
95 | Acetylation | MVKGAFQKTLSDLQL HHHHHHHHHHHHHCC | 45.00 | - | |
179 | Acetylation | NKPGLKYKPAVNQIE CCCCCCCCCCCCEEE | 25.55 | 22826441 | |
179 | Ubiquitination | NKPGLKYKPAVNQIE CCCCCCCCCCCCEEE | 25.55 | - | |
187 | Glutathionylation | PAVNQIECHPYLTQE CCCCEEECCCCCCHH | 4.12 | 24333276 | |
187 | S-nitrosylation | PAVNQIECHPYLTQE CCCCEEECCCCCCHH | 4.12 | 21278135 | |
187 | S-nitrosocysteine | PAVNQIECHPYLTQE CCCCEEECCCCCCHH | 4.12 | - | |
195 | Acetylation | HPYLTQEKLIEYCHS CCCCCHHHHHHHHHH | 44.97 | 22826441 | |
208 | Phosphorylation | HSKGIVVTAYSPLGS HHCCEEEEEECCCCC | 14.69 | 26643407 | |
210 | Phosphorylation | KGIVVTAYSPLGSPD CCEEEEEECCCCCCC | 11.06 | 26643407 | |
211 | Phosphorylation | GIVVTAYSPLGSPDR CEEEEEECCCCCCCC | 15.93 | 26643407 | |
215 | Phosphorylation | TAYSPLGSPDRPWAK EEECCCCCCCCCCCC | 31.17 | 26643407 | |
222 | Acetylation | SPDRPWAKPEDPSLL CCCCCCCCCCCCCHH | 45.10 | 23236377 | |
222 | Ubiquitination | SPDRPWAKPEDPSLL CCCCCCCCCCCCCHH | 45.10 | - | |
227 | Phosphorylation | WAKPEDPSLLEDPRI CCCCCCCCHHCCHHH | 58.89 | 21082442 | |
240 | Acetylation | RIKAIAAKYNKTTAQ HHHHHHHHCCCCCHH | 40.09 | 22826441 | |
243 | Acetylation | AIAAKYNKTTAQVLI HHHHHCCCCCHHHHE | 44.13 | 22826441 | |
263 | Acetylation | RNLVVIPKSVTPVRI CCEEEECCCCCCEEE | 46.57 | 22826441 | |
263 | Ubiquitination | RNLVVIPKSVTPVRI CCEEEECCCCCCEEE | 46.57 | - | |
264 | Phosphorylation | NLVVIPKSVTPVRIA CEEEECCCCCCEEEE | 26.35 | 25266776 | |
266 | Phosphorylation | VVIPKSVTPVRIAEN EEECCCCCCEEEECC | 24.13 | 25266776 | |
299 | Glutathionylation | YNRNWRVCALMSCAK CCCCCEEHHHHHHHH | 1.48 | 24333276 | |
304 | S-nitrosylation | RVCALMSCAKHKDYP EEHHHHHHHHCCCCC | 3.49 | 20925432 | |
304 | S-nitrosocysteine | RVCALMSCAKHKDYP EEHHHHHHHHCCCCC | 3.49 | - | |
306 | Acetylation | CALMSCAKHKDYPFH HHHHHHHHCCCCCCC | 56.36 | 22826441 | |
308 | Acetylation | LMSCAKHKDYPFHAE HHHHHHCCCCCCCCC | 59.24 | 22826441 | |
310 | Phosphorylation | SCAKHKDYPFHAEV- HHHHCCCCCCCCCC- | 16.76 | 29514104 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ALDR_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ALDR_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ALDR_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ALDR_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...