UniProt ID | AKIR2_MOUSE | |
---|---|---|
UniProt AC | B1AXD8 | |
Protein Name | Akirin-2 | |
Gene Name | Akirin2 {ECO:0000303|PubMed:18066067} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 201 | |
Subcellular Localization | Nucleus . | |
Protein Description | Forms a complex with YWHAB that acts to repress transcription of DUSP1 (By similarity). Required for embryonic development and the innate immune response. Downstream effector of the Toll-like receptor (TLR), TNF and IL-1 beta signaling pathways leading to the production of IL-6.. | |
Protein Sequence | MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPASAAASPAAATAAAAASAAAASPQKYLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLEASFQQADPGCTSDSQPHAFLISGPASPGTSSATSSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MACGATLKRTLDF --CCCCCCCEECCCC | 20.35 | 28576409 | |
10 | Phosphorylation | CGATLKRTLDFDPLL CCCCCEECCCCCCCC | 29.14 | 25619855 | |
18 | Phosphorylation | LDFDPLLSPASPKRR CCCCCCCCCCCCCCC | 26.55 | 21082442 | |
21 | Phosphorylation | DPLLSPASPKRRRCA CCCCCCCCCCCCCCC | 34.05 | 25521595 | |
31 | Phosphorylation | RRRCAPLSAPASAAA CCCCCCCCCCHHHHC | 31.02 | 25619855 | |
35 | Phosphorylation | APLSAPASAAASPAA CCCCCCHHHHCCHHH | 19.85 | 25619855 | |
39 | Phosphorylation | APASAAASPAAATAA CCHHHHCCHHHHHHH | 15.45 | 25619855 | |
44 | Phosphorylation | AASPAAATAAAAASA HCCHHHHHHHHHHHH | 16.47 | 25619855 | |
50 | Phosphorylation | ATAAAAASAAAASPQ HHHHHHHHHHHHCHH | 17.45 | 25619855 | |
55 | Phosphorylation | AASAAAASPQKYLRM HHHHHHHCHHHHHCC | 24.12 | 26824392 | |
99 | Phosphorylation | KRRHLEASFQQADPG HHHHHHHHHHHCCCC | 17.76 | 25293948 | |
108 | Phosphorylation | QQADPGCTSDSQPHA HHCCCCCCCCCCCCE | 41.29 | 25293948 | |
109 | Phosphorylation | QADPGCTSDSQPHAF HCCCCCCCCCCCCEE | 39.06 | 25293948 | |
111 | Phosphorylation | DPGCTSDSQPHAFLI CCCCCCCCCCCEEEE | 45.43 | 25293948 | |
119 | Phosphorylation | QPHAFLISGPASPGT CCCEEEECCCCCCCC | 40.65 | 25293948 | |
123 | Phosphorylation | FLISGPASPGTSSAT EEECCCCCCCCCCCC | 27.31 | 26824392 | |
126 | Phosphorylation | SGPASPGTSSATSSP CCCCCCCCCCCCCCC | 23.92 | 25293948 | |
127 | Phosphorylation | GPASPGTSSATSSPL CCCCCCCCCCCCCCC | 24.72 | 26643407 | |
128 | Phosphorylation | PASPGTSSATSSPLK CCCCCCCCCCCCCCC | 35.09 | 26643407 | |
130 | Phosphorylation | SPGTSSATSSPLKKE CCCCCCCCCCCCCCC | 31.52 | 25293948 | |
131 | Phosphorylation | PGTSSATSSPLKKEQ CCCCCCCCCCCCCCC | 29.67 | 26643407 | |
132 | Phosphorylation | GTSSATSSPLKKEQP CCCCCCCCCCCCCCC | 29.87 | 26643407 | |
184 | Phosphorylation | YDAFVKFTHDQIMRR HHHHHHCCHHHHHHH | 20.87 | 20139300 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AKIR2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AKIR2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AKIR2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of AKIR2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...