| UniProt ID | AKIR2_MOUSE | |
|---|---|---|
| UniProt AC | B1AXD8 | |
| Protein Name | Akirin-2 | |
| Gene Name | Akirin2 {ECO:0000303|PubMed:18066067} | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 201 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Forms a complex with YWHAB that acts to repress transcription of DUSP1 (By similarity). Required for embryonic development and the innate immune response. Downstream effector of the Toll-like receptor (TLR), TNF and IL-1 beta signaling pathways leading to the production of IL-6.. | |
| Protein Sequence | MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPASAAASPAAATAAAAASAAAASPQKYLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLEASFQQADPGCTSDSQPHAFLISGPASPGTSSATSSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Phosphorylation | --MACGATLKRTLDF --CCCCCCCEECCCC | 20.35 | 28576409 | |
| 10 | Phosphorylation | CGATLKRTLDFDPLL CCCCCEECCCCCCCC | 29.14 | 25619855 | |
| 18 | Phosphorylation | LDFDPLLSPASPKRR CCCCCCCCCCCCCCC | 26.55 | 21082442 | |
| 21 | Phosphorylation | DPLLSPASPKRRRCA CCCCCCCCCCCCCCC | 34.05 | 25521595 | |
| 31 | Phosphorylation | RRRCAPLSAPASAAA CCCCCCCCCCHHHHC | 31.02 | 25619855 | |
| 35 | Phosphorylation | APLSAPASAAASPAA CCCCCCHHHHCCHHH | 19.85 | 25619855 | |
| 39 | Phosphorylation | APASAAASPAAATAA CCHHHHCCHHHHHHH | 15.45 | 25619855 | |
| 44 | Phosphorylation | AASPAAATAAAAASA HCCHHHHHHHHHHHH | 16.47 | 25619855 | |
| 50 | Phosphorylation | ATAAAAASAAAASPQ HHHHHHHHHHHHCHH | 17.45 | 25619855 | |
| 55 | Phosphorylation | AASAAAASPQKYLRM HHHHHHHCHHHHHCC | 24.12 | 26824392 | |
| 99 | Phosphorylation | KRRHLEASFQQADPG HHHHHHHHHHHCCCC | 17.76 | 25293948 | |
| 108 | Phosphorylation | QQADPGCTSDSQPHA HHCCCCCCCCCCCCE | 41.29 | 25293948 | |
| 109 | Phosphorylation | QADPGCTSDSQPHAF HCCCCCCCCCCCCEE | 39.06 | 25293948 | |
| 111 | Phosphorylation | DPGCTSDSQPHAFLI CCCCCCCCCCCEEEE | 45.43 | 25293948 | |
| 119 | Phosphorylation | QPHAFLISGPASPGT CCCEEEECCCCCCCC | 40.65 | 25293948 | |
| 123 | Phosphorylation | FLISGPASPGTSSAT EEECCCCCCCCCCCC | 27.31 | 26824392 | |
| 126 | Phosphorylation | SGPASPGTSSATSSP CCCCCCCCCCCCCCC | 23.92 | 25293948 | |
| 127 | Phosphorylation | GPASPGTSSATSSPL CCCCCCCCCCCCCCC | 24.72 | 26643407 | |
| 128 | Phosphorylation | PASPGTSSATSSPLK CCCCCCCCCCCCCCC | 35.09 | 26643407 | |
| 130 | Phosphorylation | SPGTSSATSSPLKKE CCCCCCCCCCCCCCC | 31.52 | 25293948 | |
| 131 | Phosphorylation | PGTSSATSSPLKKEQ CCCCCCCCCCCCCCC | 29.67 | 26643407 | |
| 132 | Phosphorylation | GTSSATSSPLKKEQP CCCCCCCCCCCCCCC | 29.87 | 26643407 | |
| 184 | Phosphorylation | YDAFVKFTHDQIMRR HHHHHHCCHHHHHHH | 20.87 | 20139300 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AKIR2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AKIR2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AKIR2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of AKIR2_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...