UniProt ID | AKH_DROME | |
---|---|---|
UniProt AC | P61855 | |
Protein Name | Adipokinetic hormone | |
Gene Name | Akh | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 79 | |
Subcellular Localization | Secreted. | |
Protein Description | Probably causes a marked increase in hemolymph carbohydrate.. | |
Protein Sequence | MNPKSEVLIAAVLFMLLACVQCQLTFSPDWGKRSVGGAGPGTFFETQQGNCKTSNEMLLEIFRFVQSQAQLFLDCKHRE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
23 | Pyrrolidone_carboxylic_acid | LLACVQCQLTFSPDW HHHHHHCCCCCCCCC | 26.84 | - | |
23 | Pyrrolidone_carboxylic_acid | LLACVQCQLTFSPDW HHHHHHCCCCCCCCC | 26.84 | 2117437 | |
23 | Pyrrolidone_carboxylic_acid | LLACVQCQLTFSPDW HHHHHHCCCCCCCCC | 26.84 | 2117437 | |
30 | Tryptophan amide | QLTFSPDWGKRSVGG CCCCCCCCCCCCCCC | 20.00 | - | |
30 | Amidation | QLTFSPDWGKRSVGG CCCCCCCCCCCCCCC | 20.00 | 12171930 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AKH_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AKH_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AKH_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...