dbPTM

AKA7G_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	AKA7G_RAT
UniProt AC	Q6JP77
Protein Name	A-kinase anchor protein 7 isoforms delta and gamma
Gene Name	Akap7 {ECO:0000312\|RGD:1303071}
Organism	Rattus norvegicus (Rat).
Sequence Length	353
Subcellular Localization	Isoform Gamma: Nucleus . Cytoplasm . Isoform Delta: Nucleus . Cell membrane . Cotranslocates with AQP2 to the plasma membrane in response to arginine-vasopressin (AVP) stimulation in inner medullary collecting duct (IMCD) cells.
Protein Description	Probably targets cAMP-dependent protein kinase (PKA) to the cellular membrane or cytoskeletal structures. The membrane-associated form reduces epithelial sodium channel (ENaC) activity, whereas the free cytoplasmic form may negatively regulate ENaC channel feedback inhibition by intracellular sodium (By similarity). Isoform Delta may be involved in shuttling aquaporin-2 (AQP2) to the plasma membrane..
Protein Sequence	MERPAAGEIDANKCDHLSRGEEGTGDLETSPVGSLADLPFAAVDIQDDCGLPDVPQGNVPQGNPKRSKENRGDRNDHVKKRKKAKKDYQPNYFLSIPITNKKITAGIKVLQNSILRQDNRLTKAMVGDGSFHITLLVMQLLNEDEVNIGTDALLELKPFVEEILEGKHLTLPFHGIGTFQGQVGFVKLADGDHVSALLEIAETAKRTFQEKGILAGESRTFKPHLTFMKLSKAPMLWKKGVRKIEPGLYEQFIDHRFGEEILYQIDLCSMLKKKQSNGYYHCESSIVIGEKDRKEPEDAELVRLSKRLVENAVLKAVQQYLEETQNKKQPGEGNSVKAEEGDRNGDGSDNNRK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
305	Phosphorylation	DAELVRLSKRLVENA HHHHHHHHHHHHHHH		30240740

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of AKA7G_RAT !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of AKA7G_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of AKA7G_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of AKA7G_RAT !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of AKA7G_RAT

Related Literatures of Post-Translational Modification