UniProt ID | AIP_MOUSE | |
---|---|---|
UniProt AC | O08915 | |
Protein Name | AH receptor-interacting protein | |
Gene Name | Aip | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 330 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | May play a positive role in AHR-mediated (aromatic hydrocarbon receptor) signaling, possibly by influencing its receptivity for ligand and/or its nuclear targeting.. | |
Protein Sequence | MADLIARLREDGIQKRVIQEGRGELPDFQDGTKATFHFRTLHSDNEGSVIDDSRTRGKPMELIVGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAEGKDPLEGQRHCCGIAQMHEHSSLGHADLDALQQNPQPLIFHIEMLKVESPGTYQQDPWAMTDEEKAKAVPVIHQEGNRLYREGQVKEAAAKYYDAIACLKNLQMKEQPGSPDWIQLDLQITPLLLNYCQCKLVAQEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPVVSRELRALETRIRQKDEEDKARFRGIFSH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
40 | Phosphorylation | KATFHFRTLHSDNEG EEEEEEEECCCCCCC | 28.07 | 26525534 | |
43 | Phosphorylation | FHFRTLHSDNEGSVI EEEEECCCCCCCCCC | 45.29 | 26525534 | |
112 | Acetylation | LRNIAEGKDPLEGQR HHHHHCCCCCCCCCC | 47.91 | 23954790 | |
163 | Phosphorylation | KVESPGTYQQDPWAM EECCCCCCCCCCCCC | 15.30 | 29899451 | |
266 | Ubiquitination | NKYDDNVKAYFKRGK HHCCHHHHHHHHCCH | 43.56 | 22790023 | |
329 | Phosphorylation | ARFRGIFSH------ HHHCCCCCC------ | 26.77 | 21777217 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AIP_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AIP_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AIP_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of AIP_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...