dbPTM

AIP_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	AIP_MOUSE
UniProt AC	O08915
Protein Name	AH receptor-interacting protein
Gene Name	Aip
Organism	Mus musculus (Mouse).
Sequence Length	330
Subcellular Localization	Cytoplasm.
Protein Description	May play a positive role in AHR-mediated (aromatic hydrocarbon receptor) signaling, possibly by influencing its receptivity for ligand and/or its nuclear targeting..
Protein Sequence	MADLIARLREDGIQKRVIQEGRGELPDFQDGTKATFHFRTLHSDNEGSVIDDSRTRGKPMELIVGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAEGKDPLEGQRHCCGIAQMHEHSSLGHADLDALQQNPQPLIFHIEMLKVESPGTYQQDPWAMTDEEKAKAVPVIHQEGNRLYREGQVKEAAAKYYDAIACLKNLQMKEQPGSPDWIQLDLQITPLLLNYCQCKLVAQEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPVVSRELRALETRIRQKDEEDKARFRGIFSH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
40	Phosphorylation	KATFHFRTLHSDNEG EEEEEEEECCCCCCC	28.07	26525534
43	Phosphorylation	FHFRTLHSDNEGSVI EEEEECCCCCCCCCC	45.29	26525534
112	Acetylation	LRNIAEGKDPLEGQR HHHHHCCCCCCCCCC	47.91	23954790
163	Phosphorylation	KVESPGTYQQDPWAM EECCCCCCCCCCCCC	15.30	29899451
266	Ubiquitination	NKYDDNVKAYFKRGK HHCCHHHHHHHHCCH	43.56	22790023
329	Phosphorylation	ARFRGIFSH------ HHHCCCCCC------	26.77	21777217

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of AIP_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of AIP_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of AIP_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of AIP_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of AIP_MOUSE

Related Literatures of Post-Translational Modification