dbPTM

AIMP2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	AIMP2_MOUSE
UniProt AC	Q8R010
Protein Name	Aminoacyl tRNA synthase complex-interacting multifunctional protein 2
Gene Name	Aimp2
Organism	Mus musculus (Mouse).
Sequence Length	320
Subcellular Localization	Cytoplasm, cytosol . Nucleus . Following DNA damage, dissociates from the aminoacyl-tRNA synthase complex and translocates from the cytoplasm to the nucleus.
Protein Description	Required for assembly and stability of the aminoacyl-tRNA synthase complex. [PubMed: 12060739 Mediates ubiquitination and degradation of FUBP1, a transcriptional activator of MYC, leading to MYC down-regulation which is required for aveolar type II cell differentiation]
Protein Sequence	MPMYQVKPYHGGSAPLHVELPTCMYRLPNVHSKTTSPATDAGHVQETSEPSLQALESRQDDILKRLYELKAAVDGLSKMIHTPDADLDVTNILQADEPTTLATNTLDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCERYRVLSTVHTHSSVKNVPENLVKCFGEQARKQSRHEYQLGFTLIWKNVPKTQMKFSVQTMCPIEGEGNIARFLFSLFGQKHNAVTLTLIDSWVDIAMFQLREGSSKEKAAVFRSMNSALGRSPWLVGNELTVADVVLWSVLQQTGGSSGAAPTNVQRWLKSCENLAPFSTALQLLK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
34	Phosphorylation	LPNVHSKTTSPATDA CCCCCCCCCCCCCCC	35.21	27087446
35	Phosphorylation	PNVHSKTTSPATDAG CCCCCCCCCCCCCCC	36.13	28833060
36	Phosphorylation	NVHSKTTSPATDAGH CCCCCCCCCCCCCCC	20.12	27087446
39	Phosphorylation	SKTTSPATDAGHVQE CCCCCCCCCCCCCCC	29.75	22942356
47	Phosphorylation	DAGHVQETSEPSLQA CCCCCCCCCCHHHHH	22.69	26239621
48	Phosphorylation	AGHVQETSEPSLQAL CCCCCCCCCHHHHHH	46.92	26239621
51	Phosphorylation	VQETSEPSLQALESR CCCCCCHHHHHHHHC	29.12	28833060
70	Ubiquitination	LKRLYELKAAVDGLS HHHHHHHHHHHHHHH	23.51	22790023
82	Phosphorylation	GLSKMIHTPDADLDV HHHHHCCCCCCCCCH	16.37	26239621
90	Phosphorylation	PDADLDVTNILQADE CCCCCCHHHEECCCC	19.06	23984901
168	Glutathionylation	VPENLVKCFGEQARK CCHHHHHHHHHHHHH	4.06	24333276
306	S-nitrosocysteine	VQRWLKSCENLAPFS HHHHHHHCCCCCCHH	3.72	-
306	S-nitrosylation	VQRWLKSCENLAPFS HHHHHHHCCCCCCHH	3.72	21278135

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	Prkn	Q9WVS6	PMID:22199232

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of AIMP2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of AIMP2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of AIMP2_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of AIMP2_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large-scale phosphorylation analysis of mouse liver."; Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-36, AND MASSSPECTROMETRY.	17242355 [Abstract]